KEGG   Sclerotinia sclerotiorum: SS1G_00874Help
Entry
SS1G_00874        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ssl  Sclerotinia sclerotiorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1426 aa AA seqDB search
MIREQRAPSGPRPDLSPTRHRISENYNPAVGTGGSRLIAGKEPTLHAPSRTNHTLFTFGG
HNDDNSSSYDFLPSPSFDDLQTSISNELQLAPQYPASGGGDSMPREKPSMGEIKASINNG
RGPGPARGVSGPRPARTSSFQRRQSVSNRQGSISSTASSTASGNMDPPSAPLAVRTRRNQ
YPPISGSAASNAPAARLPRRSVGSDADQSNKAGTTQRQRPGLAPSTSLQSLSDVASASVR
MNNTGVPSYMDGARGTTASRTAKSKSLQPPVKGQPQVSLQPGTPDHSRSLSLATKSPGKP
SGTAIGATTPSSATSKRMSVLPGTTHASGLGARTISPTDTRRAKRLSTHHGNPVVAPGTP
PTPQPDSYPAFTPRGSSRSPSMLPRKVPTPSSSRTTPDSNRKYNSAISAASSSSCNTSRN
TTGSLQPRLSSLAPTTSRLPTPKSRNVHSSAGNNEEEDVPPVPAIPKAYESPKDSPAETP
FFAKRKSSMPFDASSINSTSTNSISGRNSAREPAKNERESKRSRHAPPSSNSDLEQQKQN
SATPKKKNLQPLRLPPLNLLPLSAPTAAKANAISNPEPLSNGTITPPPKRISTKTPSSPM
TASKTSFFSRRTEDKSERHMPQKRSNSSIHHRPAESSQVFESDAGTKPIPIASSRPPPPR
ETSPYLSSSLPKNNAGQHLMPRSKTSGDFITLDISTESKPARLTGPRALKVNRLAKSDTP
AEVSSPEEPPTPSSATSLRRKLSLGWKRSGSKNNSTASHAAGEREANHPPPPPKHDNMPP
PRLPASATMNNLSSDNNKEIPSPSPSVKSGTTTYLNSTRRKSSVSSLNLVTGHDRTKSDS
WGLHRSSPKKEASADTMTPERNIPTATSRTTSSVMHRMLNPKASSNNIRHQDHWTADLDK
DDLLAEDEMKKLGNKRKETEQAARQLDALRKRATPKDRANPQQALKLVSHLNIYEKGEIV
DYKDIYFCGTASAAKHVGQLQSDAANFGYDDDRGDYQIATGDHLSYRYEIIDVLGKGSFG
QVVRCIDHKTGGLVAIKIIRNKKRFHQQALVEVNILQKLREWDPHNKHSMVNFVQSFYFR
GHLCISTELLDMNLYELIKSNAFRGFSLKIVRRFTKQMLSSLLLLKSKKVIHCDLKPENI
LLAHPLHSEIKVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMTYGMPIDMWSLGCILAE
LYTGVPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLTVSSKGRRRR
PSSRSLQQTIKCDDEVFLDFLARCLRWDPEKRMKPDEAVRHEFITGHKLAAPPRVNARLD
SPIKRHNTTAAPSTNRPLPEPPATSHKSGTSVRPPAAGTSPSKALPPRRQSNATTLTGPP
GPKRTSTGTVTITGSSSLPRVTRSVSSKQDLASAGASAAMSSRRAL
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgattcgggaacagagggctccctcaggtccacgaccagacctttcgcctacaagacat
aggatctctgagaattacaatcccgctgtaggaacaggaggatcgcgtctgatagctggg
aaagagcctacgctacatgctccctcgcggactaaccatacattatttacattcggaggt
cacaacgacgataactcgtcatcttacgattttttgccctcccccagctttgacgacctt
caaactagcatatccaatgaactacagctggcaccacaatatccggcatcaggtggggga
gattcaatgccgagagagaagccttcaatgggggaaattaaagcatctataaacaatggt
cgagggccaggtccggcgcgtggagtgtccggaccacgaccggcacgaacctcttctttt
caacgtcgacagagtgtgagcaatcgccaaggtagcatatcttcaacggcttcctcaacg
gcatcggggaatatggatccgccatctgctcctctcgctgtgcgaactcgtcgaaaccaa
tatcctccgatctctggaagtgctgcctccaatgcgccggccgctagattgccgcgcaga
tctgtaggttctgatgcagatcagtcgaacaaggcagggaccacacaaaggcagcgtccg
ggtcttgctccaagtacatcgttacaatctttgtctgatgttgccagcgcttctgtgaga
atgaacaacacaggggtcccgagttatatggatggtgcaagaggtacaaccgcctcgagg
acagcaaaaagtaaatcactacaacctccggtgaaagggcaaccgcaagtttctcttcag
cccggcacgccagatcacagcagatcgttgtctctagctacaaaatcgccaggaaagccc
agtggaacagcaataggcgcaaccacaccatcttctgcaacttcaaagcggatgtcagtc
ttgccaggtactactcatgcaagtggacttggggctaggacgatcagccctacggacact
cgaagggccaaacgtctatcaactcaccatggaaatccagtagttgcgccaggtacaccg
ccaactccacaacccgactcatatcccgcatttactcctcgaggatcttccagatctccg
tcaatgctacctcgaaaagtccctacaccttcatcttctcgaactactccggatagtaac
cgtaagtacaattctgctatttcagctgcatcaagttcaagctgtaacacatctcgaaac
actacaggttctctacagcctcgattatcgtcccttgctcccacgacatcaaggctgcca
acacccaaatcacgaaatgtccatagttcagcgggtaataatgaagaggaggacgtacca
ccagttcctgcgatacctaaagcttatgaatctcccaaggattctcctgcagaaactcca
ttcttcgccaagagaaagtcaagtatgccttttgatgctagtagtatcaatagtacttca
acaaatagcatttctggtaggaactctgcacgcgaaccggccaagaatgagcgggagtca
aaaagatcaagacatgctcctcctagctcgaactcagatctcgaacagcaaaagcaaaac
tccgcgactcccaagaagaagaaccttcaaccacttcgtctcccgccattgaatttgtta
cctttaagtgctccaacggctgcgaaggctaacgccatatccaaccctgagcctttatca
aatggtaccattacacccccaccaaaacggatcagtaccaaaactccaagttcgcccatg
acagcatcaaaaacatcattcttttcacgtcgcaccgaagataaatctgagcgtcatatg
cctcaaaagcggagcaacagttctattcatcaccggcccgcggagtcttcgcaagtattt
gagagtgacgctgggacgaaacctatacccatagccagtagtcgaccaccaccacctaga
gaaacctctccatatttatcctcatctcttcccaaaaataacgccggccagcacctcatg
cctcgatctaaaaccagtggtgatttcattacgctggatatttcaactgaaagcaagccg
gccaggttgactgggccacgtgccttgaaagtgaaccggttagctaaaagcgacactcct
gcggaagtttcaagtcccgaggaaccgccaacaccatcctcagcaacgtcattgcgtaga
aagctaagtcttggttggaaacggtctggctccaagaataactccaccgcttctcatgcg
gcaggtgagagagaagctaatcatccacctcctcctccaaagcatgataacatgccacct
cctagattgcctgcctctgctacaatgaataatcttagtagcgacaacaacaaggaaata
cctagtcctagtccttctgtcaagtcaggtactactacttaccttaattccactagaaga
aaaagctcagtttcgagccttaatctggtcactggtcacgataggacaaagagtgatagt
tggggtttgcatcgaagcagtccgaagaaggaagcatcagcagacactatgactccggag
aggaacatcccgacagccacttcacgaaccacttcttctgtgatgcatagaatgctgaat
ccaaaggcgtctagtaacaatattaggcatcaggatcattggaccgcggacttggacaag
gacgatcttctagcagaagacgaaatgaagaaacttggtaataaacgaaaagaaacagag
caggcagctcgtcaattggatgctttgagaaaacgtgctactcctaaggatcgagcgaat
cctcaacaggctcttaaactcgtctcgcatcttaacatttacgaaaaaggggaaatagtc
gactacaaggatatctacttttgcggaactgccagcgcagctaaacatgttggtcaactt
caatctgatgccgctaattttggttatgatgatgatagaggagattaccaaatcgccact
ggagatcatctctcgtatcgctatgagattatcgacgttctcggtaaaggaagttttggt
caagtcgtcagatgtattgatcacaagacagggggattagtggctatcaagatcatccga
aacaagaagaggttccatcagcaagctttggtggaggttaacattctccaaaagttgcgt
gaatgggacccccacaacaagcacagcatggtcaattttgttcaaagcttctacttccgt
ggtcatctttgcatttctactgagcttttagatatgaatctctatgagcttataaaatcg
aatgctttccgcggtttctctctcaagatcgttcgacgatttacaaaacagatgctcagc
agtttgttgcttttgaagtcaaagaaggtcatccactgtgatctgaaacctgaaaacatt
cttcttgctcatccactccattccgagattaaggttattgattttgggtcaagttgtttc
gagaacgagaaggtatatacatatattcaatcccgattctaccgatcaccggaagtcatt
cttggtatgacatatggtatgccgatagatatgtggagtcttggatgcatcttggcagag
ctttatactggagtacccatctttcctggtgagaatgagcaggaacaactagcctgcatc
atggaagtttttggtccaccggagaagcatctgattgagaaaagtacccgcaaaaagctt
ttctttgattcgctcggaaaaccacgcctcactgtatcgtcgaaaggacgtagacgtcga
ccatcttcgagatctcttcagcaaacgatcaaatgtgacgacgaggttttcctcgacttc
ttggctcgttgtctcaggtgggatcccgaaaagcgtatgaagcctgatgaagctgttaga
catgagttcatcactggtcataagcttgctgctccacctcgtgtcaatgctcgactcgac
tcaccgatcaagcgacacaatactaccgccgcaccttccacaaacagacctctcccagaa
ccacctgccaccagtcacaaaagtgggacatctgttagaccacctgctgctggaactagt
ccgagtaaagctcttcctcctcgacgacaatccaatgccacaacattgactggacctcct
gggccgaaacgcacaagtactggaaccgttacaattactggtagtagtagtttaccccga
gttacgcgaagtgtaagctcgaaacaggatttagcatctgcgggggcatcggcggctatg
agtagtcggcgagcattatag

DBGET integrated database retrieval system