KEGG   Sclerotinia sclerotiorum: SS1G_01273Help
Entry
SS1G_01273        CDS       T01071                                 

Definition
similar to hexokinase
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SS1G_01273
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_01273
   00051 Fructose and mannose metabolism
    SS1G_01273
   00052 Galactose metabolism
    SS1G_01273
   00500 Starch and sucrose metabolism
    SS1G_01273
   00520 Amino sugar and nucleotide sugar metabolism
    SS1G_01273
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    SS1G_01273
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SS1G_01273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MVGLGPRKPPSRKGSMAEVPKNFLEQIKKLEQQFTVDTKKLKEITEHFVSELTKGLTVEG
GSIPMNPTWCMSFPDGYETGTFLALDMGGTNLRVCEIILTDEKSEFDIMQSKYRMPEELK
TGDADELWEYIADCLQQFIESHHQGEKLDKLSLGFTFSYPATQNYIDEGILQRWTKGFDI
EGVEGENVVPMFEAALAKRGVPIKLTALINDTTGTLIASAYTDTSMKIGCIFGTGCNAAY
MENCGSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHDNKDIHIFEGQDIEKLRKAYTLDSSFLSLVEEDPFENLSET
ADLFQNKLGIVTTVPELELIRRLAELIGTRAARLSACGVAAIAKKKGYETCHVGADGSVF
NKYPHFKARGAAALREILDWPAKKSPKEHDPIEILAAEDGSGVGAALIAALTLKRVKEGN
MAGILHPENFR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtggggttaggtccaagaaagcctccttcccgtaagggttccatggcggaggttcca
aagaatttcttggagcaaatcaagaaacttgagcaacagttcaccgttgacaccaaaaag
ctcaaggagatcaccgaacatttcgtctctgagcttactaaaggtctcacggtggagggt
ggaagtattccaatgaacccaacatggtgtatgtctttcccagacggttatgaaacaggc
actttcctcgccttggacatgggaggtaccaacttgcgtgtctgtgagatcattttgacc
gatgagaagtctgagttcgatattatgcaatcaaagtatcgcatgcctgaagagctcaaa
actggtgatgccgatgagctttgggagtatattgcggattgtcttcagcagtttatcgag
tcccatcaccagggcgagaagcttgacaaattgagtcttggtttcaccttttcttaccca
gctacccagaactacattgatgagggtattttgcaaagatggaccaagggtttcgatatt
gaaggtgttgagggcgagaacgttgttccaatgttcgaagcagctcttgctaagagaggt
gtgccaattaagctcactgctttgatcaatgataccaccggtactttgatcgcttccgca
tacactgatacatccatgaagattggatgtatctttggaactggttgcaatgctgcttac
atggaaaattgtggctccattccaaaattggcccacatgaacctacctcctgacactcca
atggctatcaactgcgagtggggtgcttttgacaatgaacacaaagttctcccccgtact
ccatacgatatcattattgataaagattctccacgtcccggtcagcaagcatttgagaag
atgattgctggtctttaccttggagaacttttcagattggttctagttgatcttcacgac
aacaaagacattcacatctttgagggtcaggacatcgagaagctccgaaaagcttatacc
ttggactcttctttcttatccttggttgaggaggatccattcgagaacttgtccgagaca
gctgacctgttccaaaacaagctcggcatagtcaccactgttccagaacttgagcttatc
cgccgtctcgctgagttaatcggtacccgtgccgcccgtctttccgcctgtggtgttgcc
gccattgccaagaagaagggttatgagacctgccacgttggagctgatggatcagtcttc
aacaaataccctcacttcaaggctcgtggtgcggcagcacttcgtgaaattcttgattgg
cctgccaagaagagtcctaaggagcatgatcctattgaaatcttggccgccgaagatgga
tctggtgtcggtgcagctttgattgctgctttgaccctcaagcgtgttaaggaaggtaac
atggctggtatcttgcacccagagaacttcagatga

DBGET integrated database retrieval system