KEGG   Sclerotinia sclerotiorum: SS1G_01273Help
Entry
SS1G_01273        CDS       T01071                                 

Definition
similar to hexokinase
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ssl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ssl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssl00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssl00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MVGLGPRKPPSRKGSMAEVPKNFLEQIKKLEQQFTVDTKKLKEITEHFVSELTKGLTVEG
GSIPMNPTWCMSFPDGYETGTFLALDMGGTNLRVCEIILTDEKSEFDIMQSKYRMPEELK
TGDADELWEYIADCLQQFIESHHQGEKLDKLSLGFTFSYPATQNYIDEGILQRWTKGFDI
EGVEGENVVPMFEAALAKRGVPIKLTALINDTTGTLIASAYTDTSMKIGCIFGTGCNAAY
MENCGSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHDNKDIHIFEGQDIEKLRKAYTLDSSFLSLVEEDPFENLSET
ADLFQNKLGIVTTVPELELIRRLAELIGTRAARLSACGVAAIAKKKGYETCHVGADGSVF
NKYPHFKARGAAALREILDWPAKKSPKEHDPIEILAAEDGSGVGAALIAALTLKRVKEGN
MAGILHPENFR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtggggttaggtccaagaaagcctccttcccgtaagggttccatggcggaggttcca
aagaatttcttggagcaaatcaagaaacttgagcaacagttcaccgttgacaccaaaaag
ctcaaggagatcaccgaacatttcgtctctgagcttactaaaggtctcacggtggagggt
ggaagtattccaatgaacccaacatggtgtatgtctttcccagacggttatgaaacaggc
actttcctcgccttggacatgggaggtaccaacttgcgtgtctgtgagatcattttgacc
gatgagaagtctgagttcgatattatgcaatcaaagtatcgcatgcctgaagagctcaaa
actggtgatgccgatgagctttgggagtatattgcggattgtcttcagcagtttatcgag
tcccatcaccagggcgagaagcttgacaaattgagtcttggtttcaccttttcttaccca
gctacccagaactacattgatgagggtattttgcaaagatggaccaagggtttcgatatt
gaaggtgttgagggcgagaacgttgttccaatgttcgaagcagctcttgctaagagaggt
gtgccaattaagctcactgctttgatcaatgataccaccggtactttgatcgcttccgca
tacactgatacatccatgaagattggatgtatctttggaactggttgcaatgctgcttac
atggaaaattgtggctccattccaaaattggcccacatgaacctacctcctgacactcca
atggctatcaactgcgagtggggtgcttttgacaatgaacacaaagttctcccccgtact
ccatacgatatcattattgataaagattctccacgtcccggtcagcaagcatttgagaag
atgattgctggtctttaccttggagaacttttcagattggttctagttgatcttcacgac
aacaaagacattcacatctttgagggtcaggacatcgagaagctccgaaaagcttatacc
ttggactcttctttcttatccttggttgaggaggatccattcgagaacttgtccgagaca
gctgacctgttccaaaacaagctcggcatagtcaccactgttccagaacttgagcttatc
cgccgtctcgctgagttaatcggtacccgtgccgcccgtctttccgcctgtggtgttgcc
gccattgccaagaagaagggttatgagacctgccacgttggagctgatggatcagtcttc
aacaaataccctcacttcaaggctcgtggtgcggcagcacttcgtgaaattcttgattgg
cctgccaagaagagtcctaaggagcatgatcctattgaaatcttggccgccgaagatgga
tctggtgtcggtgcagctttgattgctgctttgaccctcaagcgtgttaaggaaggtaac
atggctggtatcttgcacccagagaacttcagatga

DBGET integrated database retrieval system