KEGG   Sclerotinia sclerotiorum: SS1G_01273Help
Entry
SS1G_01273        CDS       T01071                                 

Definition
similar to hexokinase
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SS1G_01273
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_01273
   00051 Fructose and mannose metabolism
    SS1G_01273
   00052 Galactose metabolism
    SS1G_01273
   00500 Starch and sucrose metabolism
    SS1G_01273
   00520 Amino sugar and nucleotide sugar metabolism
    SS1G_01273
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    SS1G_01273
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SS1G_01273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MVGLGPRKPPSRKGSMAEVPKNFLEQIKKLEQQFTVDTKKLKEITEHFVSELTKGLTVEG
GSIPMNPTWCMSFPDGYETGTFLALDMGGTNLRVCEIILTDEKSEFDIMQSKYRMPEELK
TGDADELWEYIADCLQQFIESHHQGEKLDKLSLGFTFSYPATQNYIDEGILQRWTKGFDI
EGVEGENVVPMFEAALAKRGVPIKLTALINDTTGTLIASAYTDTSMKIGCIFGTGCNAAY
MENCGSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHDNKDIHIFEGQDIEKLRKAYTLDSSFLSLVEEDPFENLSET
ADLFQNKLGIVTTVPELELIRRLAELIGTRAARLSACGVAAIAKKKGYETCHVGADGSVF
NKYPHFKARGAAALREILDWPAKKSPKEHDPIEILAAEDGSGVGAALIAALTLKRVKEGN
MAGILHPENFR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtggggttaggtccaagaaagcctccttcccgtaagggttccatggcggaggttcca
aagaatttcttggagcaaatcaagaaacttgagcaacagttcaccgttgacaccaaaaag
ctcaaggagatcaccgaacatttcgtctctgagcttactaaaggtctcacggtggagggt
ggaagtattccaatgaacccaacatggtgtatgtctttcccagacggttatgaaacaggc
actttcctcgccttggacatgggaggtaccaacttgcgtgtctgtgagatcattttgacc
gatgagaagtctgagttcgatattatgcaatcaaagtatcgcatgcctgaagagctcaaa
actggtgatgccgatgagctttgggagtatattgcggattgtcttcagcagtttatcgag
tcccatcaccagggcgagaagcttgacaaattgagtcttggtttcaccttttcttaccca
gctacccagaactacattgatgagggtattttgcaaagatggaccaagggtttcgatatt
gaaggtgttgagggcgagaacgttgttccaatgttcgaagcagctcttgctaagagaggt
gtgccaattaagctcactgctttgatcaatgataccaccggtactttgatcgcttccgca
tacactgatacatccatgaagattggatgtatctttggaactggttgcaatgctgcttac
atggaaaattgtggctccattccaaaattggcccacatgaacctacctcctgacactcca
atggctatcaactgcgagtggggtgcttttgacaatgaacacaaagttctcccccgtact
ccatacgatatcattattgataaagattctccacgtcccggtcagcaagcatttgagaag
atgattgctggtctttaccttggagaacttttcagattggttctagttgatcttcacgac
aacaaagacattcacatctttgagggtcaggacatcgagaagctccgaaaagcttatacc
ttggactcttctttcttatccttggttgaggaggatccattcgagaacttgtccgagaca
gctgacctgttccaaaacaagctcggcatagtcaccactgttccagaacttgagcttatc
cgccgtctcgctgagttaatcggtacccgtgccgcccgtctttccgcctgtggtgttgcc
gccattgccaagaagaagggttatgagacctgccacgttggagctgatggatcagtcttc
aacaaataccctcacttcaaggctcgtggtgcggcagcacttcgtgaaattcttgattgg
cctgccaagaagagtcctaaggagcatgatcctattgaaatcttggccgccgaagatgga
tctggtgtcggtgcagctttgattgctgctttgaccctcaagcgtgttaaggaaggtaac
atggctggtatcttgcacccagagaacttcagatga

DBGET integrated database retrieval system