KEGG   Sclerotinia sclerotiorum: SS1G_01433Help
Entry
SS1G_01433        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SS1G_01433
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SS1G_01433
Protein kinases [BR:ssl01001]
 Serine/threonine protein kinases: Other group
  TTK family
   SS1G_01433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 842 aa AA seqDB search
MATASPTPTSSSQFAAIRRPASRNAYKQPLSRPSSTRPDVETARHYSLNDSSDDEIPMPM
KLSALTKALLNDEASIMEPSTRTTPEPSHTSHTRAESAGILGTSTRQNQSPIGSNEHSPT
YPRRVVRLSGTPGSSTLRRGASLSSAVQKHNEQQAAPKAGEGALDLSTPAPVPRTVRVSI
GRSSIGSSGRRSGRPESPQQEDVYENDGPQEYPSTVTRSHLAANQGSVSRYNPSTVSRSR
YGEEIGLQSSMRVKRSAVPKVFGTFMRGPARRGRPRISQSDEEHSPMEENANSNDIGSNQ
EPQSQESQYEQRESQNKSPTPEIEVARRAPVSSFRDFAASGSPPSSNGFLNSVLRSTSPP
PTLSSSRTSDPRSIPSASQQQHPVFKIPAPRSGLPVTHDQENEAPPTFKRSKQPLIQTNS
ADKYRRPESFDKNSVRASGSPERRPLAVRSQNTPQRPAPPPPKMSVLEAATSTAGAATTS
HANNRRNRLKVNGKIFTRLDVIGRGGSSKVYRVMAENSKIFALKRVSLEDADESAIRGFK
GEIDLLKKLGSVERVIHLYDYELNDERGTLSVLMEMGELDMNTILNLRMKSEQAKLDINF
VRYYWKEMLECLQAVHAYDIVHSDLKPHNFVLVQGRLKLIDFGIANAIQTEETVNVHRET
QIGTPNYMSPESLMDSNASDGKNRNEPKLMKLGKPSDIWSLGCILYQMTYGRAPFGHIQN
QLQRCQAIINFSYEIEYPTYGVGGVLVPSSLIRTLKNCLNRDQHKRPSVEELLGDDDTFL
YPLEIDMDKHFPMTEELLGRILQNVIQKCETLGRVPSEGELLTSWPKGYFASLRKAEQRG
GA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagcttcaccaacccccacaagctcgagtcaattcgcagccattcgaagacct
gcctcacgaaatgcatataaacaacctctcagtcgaccatcttctacaagacctgatgta
gaaacagctcgacattattcactcaacgacagctccgatgacgaaatccccatgccaatg
aagttgagtgccttaacgaaagctttacttaacgatgaggcttcaattatggaaccttct
actcgtacgacacccgagccgtctcatacatcacacacaagagcggaaagtgcgggtata
ttaggaacatctactagacagaaccaatcgccgataggaagcaatgaacatagtcccacc
tatccgcgacgagttgtgcgattgagtggtacgcctggctcctcaactttacgaagaggg
gcttcattgtccagtgcggtccaaaaacacaatgaacagcaagcggcaccaaaagcgggg
gagggcgcattagatcttagcacaccggcaccagtaccaaggaccgtacgggtatctatc
gggagatcttcaattggatcttctgggagaaggtctggcagaccagagtcgccacagcag
gaggatgtgtatgagaatgatggaccacaagaatatccttcgacggttacaagatcacat
ttagctgcgaaccagggaagtgtatcgaggtataacccctctactgttagtcgttcgagg
tatggtgaagagataggattgcagagttcaatgagagtcaaaagaagtgcagtccctaaa
gtatttggtacatttatgagaggcccagctcggagaggacgaccgcggatatctcagtca
gatgaagaacacagcccaatggaggaaaacgcaaacagcaacgatattggatctaatcag
gagcctcaaagccaggaatcgcaatacgagcagcgggaaagccagaataaaagccccact
ccggaaatagaagtagctagaagagctccagtctcgtcgtttagagattttgctgcttca
ggaagtcctcctagctcgaatggctttctgaattccgtcttgcgttctacgtctccacca
ccaactttatcaagctctcggacatctgaccctcgctcaattccctccgcgtcgcaacaa
caacatcctgtattcaagataccagctccacgttcaggtcttcctgtgactcacgatcaa
gagaatgaagcgccaccaactttcaagcgaagcaagcaacctttgatacagacgaatagc
gcagataaatatcgccgaccagaaagcttcgacaagaactctgtacgtgctagtgggtct
cctgaaagacgacctctggctgtccggagtcagaatactcctcaaagacctgctccacca
ccacctaagatgtccgtattagaagcagctactagtactgctggcgctgccactacatcg
cacgccaataaccggagaaacaggctgaaggtcaatggcaaaatattcacacgcctcgat
gttattggacgtggaggtagctcaaaagtttaccgagttatggcagagaactcgaagata
tttgcattgaagcgcgtctccttggaagatgctgatgaatcggctatacgtggtttcaag
ggtgaaattgatttattgaagaaattgggctcggttgaaagagtgattcatttatatgac
tacgagctaaatgacgagagagggacacttagtgtgcttatggagatgggtgaattggat
atgaacactatccttaacctacgcatgaaatctgaacaagccaagctggatatcaatttc
gtgcgctattactggaaagaaatgctcgagtgtcttcaagccgttcacgcttatgacata
gtccactctgatctcaaacctcacaattttgttcttgttcaaggtcgtctgaagctcata
gattttggtatcgccaacgcaatccaaactgaagaaactgtgaacgttcaccgtgaaaca
caaatcggcactccaaactacatgtctcccgaatcactcatggactccaatgcttctgat
gggaaaaatcgcaatgaaccaaaactcatgaaactgggaaaaccatccgatatttggagt
ttgggttgtatactgtatcaaatgacctacggtcgtgccccatttggtcatatccaaaac
cagctacagcgctgccaagcaatcataaacttcagctatgaaatcgaatatccaacatat
ggggtaggcggtgttctggtccccagctctcttatccgaacacttaagaactgcttgaac
agagatcagcataagagaccatctgtggaagaattactaggggatgatgatacatttctg
tatccgttggagattgatatggacaagcactttcccatgactgaagagttgctaggcaga
attttgcaaaatgtgatacaaaaatgcgagactcttgggagggtacctagtgagggagaa
cttttgacttcgtggcccaagggctattttgcaagtttgcgaaaggcggagcaaaggggt
ggagcataa

DBGET integrated database retrieval system