KEGG   Sclerotinia sclerotiorum: SS1G_01433Help
Entry
SS1G_01433        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ssl04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 842 aa AA seqDB search
MATASPTPTSSSQFAAIRRPASRNAYKQPLSRPSSTRPDVETARHYSLNDSSDDEIPMPM
KLSALTKALLNDEASIMEPSTRTTPEPSHTSHTRAESAGILGTSTRQNQSPIGSNEHSPT
YPRRVVRLSGTPGSSTLRRGASLSSAVQKHNEQQAAPKAGEGALDLSTPAPVPRTVRVSI
GRSSIGSSGRRSGRPESPQQEDVYENDGPQEYPSTVTRSHLAANQGSVSRYNPSTVSRSR
YGEEIGLQSSMRVKRSAVPKVFGTFMRGPARRGRPRISQSDEEHSPMEENANSNDIGSNQ
EPQSQESQYEQRESQNKSPTPEIEVARRAPVSSFRDFAASGSPPSSNGFLNSVLRSTSPP
PTLSSSRTSDPRSIPSASQQQHPVFKIPAPRSGLPVTHDQENEAPPTFKRSKQPLIQTNS
ADKYRRPESFDKNSVRASGSPERRPLAVRSQNTPQRPAPPPPKMSVLEAATSTAGAATTS
HANNRRNRLKVNGKIFTRLDVIGRGGSSKVYRVMAENSKIFALKRVSLEDADESAIRGFK
GEIDLLKKLGSVERVIHLYDYELNDERGTLSVLMEMGELDMNTILNLRMKSEQAKLDINF
VRYYWKEMLECLQAVHAYDIVHSDLKPHNFVLVQGRLKLIDFGIANAIQTEETVNVHRET
QIGTPNYMSPESLMDSNASDGKNRNEPKLMKLGKPSDIWSLGCILYQMTYGRAPFGHIQN
QLQRCQAIINFSYEIEYPTYGVGGVLVPSSLIRTLKNCLNRDQHKRPSVEELLGDDDTFL
YPLEIDMDKHFPMTEELLGRILQNVIQKCETLGRVPSEGELLTSWPKGYFASLRKAEQRG
GA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagcttcaccaacccccacaagctcgagtcaattcgcagccattcgaagacct
gcctcacgaaatgcatataaacaacctctcagtcgaccatcttctacaagacctgatgta
gaaacagctcgacattattcactcaacgacagctccgatgacgaaatccccatgccaatg
aagttgagtgccttaacgaaagctttacttaacgatgaggcttcaattatggaaccttct
actcgtacgacacccgagccgtctcatacatcacacacaagagcggaaagtgcgggtata
ttaggaacatctactagacagaaccaatcgccgataggaagcaatgaacatagtcccacc
tatccgcgacgagttgtgcgattgagtggtacgcctggctcctcaactttacgaagaggg
gcttcattgtccagtgcggtccaaaaacacaatgaacagcaagcggcaccaaaagcgggg
gagggcgcattagatcttagcacaccggcaccagtaccaaggaccgtacgggtatctatc
gggagatcttcaattggatcttctgggagaaggtctggcagaccagagtcgccacagcag
gaggatgtgtatgagaatgatggaccacaagaatatccttcgacggttacaagatcacat
ttagctgcgaaccagggaagtgtatcgaggtataacccctctactgttagtcgttcgagg
tatggtgaagagataggattgcagagttcaatgagagtcaaaagaagtgcagtccctaaa
gtatttggtacatttatgagaggcccagctcggagaggacgaccgcggatatctcagtca
gatgaagaacacagcccaatggaggaaaacgcaaacagcaacgatattggatctaatcag
gagcctcaaagccaggaatcgcaatacgagcagcgggaaagccagaataaaagccccact
ccggaaatagaagtagctagaagagctccagtctcgtcgtttagagattttgctgcttca
ggaagtcctcctagctcgaatggctttctgaattccgtcttgcgttctacgtctccacca
ccaactttatcaagctctcggacatctgaccctcgctcaattccctccgcgtcgcaacaa
caacatcctgtattcaagataccagctccacgttcaggtcttcctgtgactcacgatcaa
gagaatgaagcgccaccaactttcaagcgaagcaagcaacctttgatacagacgaatagc
gcagataaatatcgccgaccagaaagcttcgacaagaactctgtacgtgctagtgggtct
cctgaaagacgacctctggctgtccggagtcagaatactcctcaaagacctgctccacca
ccacctaagatgtccgtattagaagcagctactagtactgctggcgctgccactacatcg
cacgccaataaccggagaaacaggctgaaggtcaatggcaaaatattcacacgcctcgat
gttattggacgtggaggtagctcaaaagtttaccgagttatggcagagaactcgaagata
tttgcattgaagcgcgtctccttggaagatgctgatgaatcggctatacgtggtttcaag
ggtgaaattgatttattgaagaaattgggctcggttgaaagagtgattcatttatatgac
tacgagctaaatgacgagagagggacacttagtgtgcttatggagatgggtgaattggat
atgaacactatccttaacctacgcatgaaatctgaacaagccaagctggatatcaatttc
gtgcgctattactggaaagaaatgctcgagtgtcttcaagccgttcacgcttatgacata
gtccactctgatctcaaacctcacaattttgttcttgttcaaggtcgtctgaagctcata
gattttggtatcgccaacgcaatccaaactgaagaaactgtgaacgttcaccgtgaaaca
caaatcggcactccaaactacatgtctcccgaatcactcatggactccaatgcttctgat
gggaaaaatcgcaatgaaccaaaactcatgaaactgggaaaaccatccgatatttggagt
ttgggttgtatactgtatcaaatgacctacggtcgtgccccatttggtcatatccaaaac
cagctacagcgctgccaagcaatcataaacttcagctatgaaatcgaatatccaacatat
ggggtaggcggtgttctggtccccagctctcttatccgaacacttaagaactgcttgaac
agagatcagcataagagaccatctgtggaagaattactaggggatgatgatacatttctg
tatccgttggagattgatatggacaagcactttcccatgactgaagagttgctaggcaga
attttgcaaaatgtgatacaaaaatgcgagactcttgggagggtacctagtgagggagaa
cttttgacttcgtggcccaagggctattttgcaagtttgcgaaaggcggagcaaaggggt
ggagcataa

DBGET integrated database retrieval system