KEGG   Sclerotinia sclerotiorum: SS1G_01799Help
Entry
SS1G_01799        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SS1G_01799
  Lipid metabolism
   00561 Glycerolipid metabolism
    SS1G_01799
   00600 Sphingolipid metabolism
    SS1G_01799
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    SS1G_01799
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SS1G_01799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MGWSTWNQFGPLITSTLIQSTINSMVHNQLQNAGYIYINIDDGWQRHKGPRSSYPLEADP
IKFPNGIKALADYAHERGFKLGIYSGPGDVTCAGYTGSLGHEEEDARMFAEWGVDHLKYD
SEAPKSKVQEIVLKMSKALRASGRAIVYHACHCGWADIWEWAAEEGANQWRIGQDISDDF
NYPGKREKYYFDVLDMIDRGNNLVQYSGPGHWNDYDVLIVGLNGNSTQLVGTGASNIEYR
THFSMWAMVASPLLIGSDIRTLDMYDLQTLTNREIIEINQDSLGISAQTVGVGYQADGDL
QVYAKEMSDGSYAVALLNRGSFTAEMSLSPRRDLLMTWDHYRVRDLWKHREGIYDIPYTV
EVMPHEAKILRVWEVQANASMCLFQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggctggagcacctggaaccaattcggccccctaatcacctccaccctaatccaaagc
accatcaacagcatggtccacaaccaactccaaaacgccggatacatctacataaacatc
gacgacggatggcaacggcacaaaggcccacgatcatcctaccctctcgaagccgatcct
attaaattcccaaacggcataaaagcactagcagattatgcacatgaacgaggatttaaa
ttaggtatttattcaggtcctggtgatgtgacgtgtgcgggatatacggggagtttgggg
catgaagaggaagatgcgaggatgtttgctgagtggggagttgatcatttgaaatatgat
agcgaagcaccaaaatccaaagtccaagaaattgtattgaaaatgtcaaaggctttacga
gcgagtggtcgtgcaatcgtataccatgcatgtcattgtggatgggccgatatctgggaa
tgggctgcagaagagggagcaaatcaatggcgaatcggacaagacatctctgacgatttc
aactatccgggaaagcgagaaaaatattatttcgacgtattagatatgatagatcgagga
aataacctagtgcaatattcgggtccgggtcattggaatgattatgatgtgcttattgtt
ggtctgaatggaaattctactcagctggttggaacgggtgcgtcgaatattgagtatcgt
actcattttagtatgtgggctatggttgcttctcctttgcttattggttctgatatacgc
actttggatatgtatgatcttcaaactcttacgaatagggagattattgagataaatcaa
gattcgctgggaatatcggctcaaacggttggtgtaggttatcaagctgatggggatctt
caagtatatgctaaagaaatgtcggatgggagttatgccgttgcactactcaatcgggga
agtttcactgcggaaatgagcttgagtcctcggcgggatcttcttatgacttgggatcat
tatcgagttcgtgatttgtggaaacatagggaggggatttatgatattccatatactgtg
gaagtaatgcctcatgaagctaagattttgagagtttgggaagttcaagccaatgcatca
atgtgcttgttccagtaa

DBGET integrated database retrieval system