KEGG   Sclerotinia sclerotiorum: SS1G_01799Help
Entry
SS1G_01799        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ssl00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ssl00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MGWSTWNQFGPLITSTLIQSTINSMVHNQLQNAGYIYINIDDGWQRHKGPRSSYPLEADP
IKFPNGIKALADYAHERGFKLGIYSGPGDVTCAGYTGSLGHEEEDARMFAEWGVDHLKYD
SEAPKSKVQEIVLKMSKALRASGRAIVYHACHCGWADIWEWAAEEGANQWRIGQDISDDF
NYPGKREKYYFDVLDMIDRGNNLVQYSGPGHWNDYDVLIVGLNGNSTQLVGTGASNIEYR
THFSMWAMVASPLLIGSDIRTLDMYDLQTLTNREIIEINQDSLGISAQTVGVGYQADGDL
QVYAKEMSDGSYAVALLNRGSFTAEMSLSPRRDLLMTWDHYRVRDLWKHREGIYDIPYTV
EVMPHEAKILRVWEVQANASMCLFQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggctggagcacctggaaccaattcggccccctaatcacctccaccctaatccaaagc
accatcaacagcatggtccacaaccaactccaaaacgccggatacatctacataaacatc
gacgacggatggcaacggcacaaaggcccacgatcatcctaccctctcgaagccgatcct
attaaattcccaaacggcataaaagcactagcagattatgcacatgaacgaggatttaaa
ttaggtatttattcaggtcctggtgatgtgacgtgtgcgggatatacggggagtttgggg
catgaagaggaagatgcgaggatgtttgctgagtggggagttgatcatttgaaatatgat
agcgaagcaccaaaatccaaagtccaagaaattgtattgaaaatgtcaaaggctttacga
gcgagtggtcgtgcaatcgtataccatgcatgtcattgtggatgggccgatatctgggaa
tgggctgcagaagagggagcaaatcaatggcgaatcggacaagacatctctgacgatttc
aactatccgggaaagcgagaaaaatattatttcgacgtattagatatgatagatcgagga
aataacctagtgcaatattcgggtccgggtcattggaatgattatgatgtgcttattgtt
ggtctgaatggaaattctactcagctggttggaacgggtgcgtcgaatattgagtatcgt
actcattttagtatgtgggctatggttgcttctcctttgcttattggttctgatatacgc
actttggatatgtatgatcttcaaactcttacgaatagggagattattgagataaatcaa
gattcgctgggaatatcggctcaaacggttggtgtaggttatcaagctgatggggatctt
caagtatatgctaaagaaatgtcggatgggagttatgccgttgcactactcaatcgggga
agtttcactgcggaaatgagcttgagtcctcggcgggatcttcttatgacttgggatcat
tatcgagttcgtgatttgtggaaacatagggaggggatttatgatattccatatactgtg
gaagtaatgcctcatgaagctaagattttgagagtttgggaagttcaagccaatgcatca
atgtgcttgttccagtaa

DBGET integrated database retrieval system