KEGG   Sclerotinia sclerotiorum: SS1G_01831Help
Entry
SS1G_01831        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ssl00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 771 aa AA seqDB search
MSSQGSVRKRKGGSVPPQGKDKDASVVAAPHPELDALVKDIQTKTGPEWDYRIALFIITV
LAFVTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFGKLLFALMGWFVGYDGH
FHFENIGDSYIDNKVPYVAFRAMPALLGALTVPTVFAIMWESGYTLPACVLSASLVLFDN
AHIGQTRLILLDATLVLAMACSLLCYIKFYKLRHVPFSRKWWKWLLLTGFALSCDISTKY
VGTFAFVTIGSAVAIDLWSLLDINRRQGSLSLPEFGKHFAARAVALIIVPFLFYLFWFQV
HFAILTKSGPGDDFMSPEFQETLSDNAMTANAVNINYFDNIQIKHKETHGYLHSHPDTYP
LRYDDGRVSSQGQQVTGYPYADANNHWQIIPAGTFEEVAGRPVRNGEVVRLRHVVTNTML
LSHDVASPYYPTNQEFTTVSLEEALGDRLNDTLFELRIENGKPRQDFKSLQGQFKLIHWP
SKVAMWTHTTPLPDWGYKQQEINGNKNLAQSSNIWYVDEIPSIPKDSPRLIKEERKVKSV
PFLKKWFELQRAMFYHNNALTSSHPYASEPFVWPFLLRGVSFWTQNDTRQQIYFLGNPLG
WWLASSLLAVYAGIWAADQLSLRRGVDALDNRTRSRLYNSTGFFFLAWATHYLPFYLMGR
QLFLHHYLPAHLASCLITGALLEFIFNVEPVLDDIPSGAAKKAGAVKKHLPAREKLAGQN
LMMSWAAVVVILSVVLFGWYYFLPLTYGYPGLSVPEVNARKWLGYDLHFAK
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcaaggttcagttcgaaaacgaaaaggtggttcagttccacctcaaggaaaa
gacaaagatgcctctgttgttgcagctcctcatcctgagctcgatgctctggtgaaagat
atacagaccaaaaccggaccagaatgggattacaggattgcattgtttatcatcacggtt
ctggcatttgtcacaagattttggggaatcagccatccaaatgaggtggtgtttgacgaa
gtccatttcggcaagtttgcttcatattaccttgaacgaacctacttcttcgatgttcat
cctcctttcggaaagcttcttttcgccttgatgggttggtttgtcggatatgatgggcat
ttccatttcgaaaacattggggactcgtacatcgataacaaggtgccatatgtggctttc
cgcgctatgcccgctctcctcggagctttaacagtcccaactgtcttcgctatcatgtgg
gaatctggttatactctacctgcctgcgtcctctccgcttcattggtactattcgacaac
gcccacatcggccaaacccgcttgatcttattggatgccactcttgttcttgcaatggca
tgcagtctcctctgttatatcaagttttacaaactccgacatgtcccattttcgagaaag
tggtggaagtggctccttttgacaggattcgctttaagttgcgacatctccaccaagtac
gttggcacgttcgcatttgttacaattggttccgcagtcgcaattgatctctggagtttg
ttggacatcaatcgtcgccagggttctttgagcttaccagaatttggcaagcatttcgca
gctcgtgctgttgccctcatcattgtaccgttcctcttctacttgttttggttccaggta
catttcgcaatcttgaccaaatctggtcctggtgatgatttcatgtcccctgaattccaa
gagacgcttagcgacaatgccatgaccgcaaatgccgttaacattaattattttgacaac
attcaaatcaagcacaaggaaacacatggatacttacacagccatcccgatacatatcct
ctgagatatgatgacggtagagtctctagtcaaggtcagcaagtcactggctacccatat
gccgatgccaacaaccattggcaaatcatccctgcaggcacttttgaagaggttgctggc
cgccctgttaggaacggcgaagttgttagattaagacatgtggtcacaaacacaatgctc
ttgtcacacgatgttgcttctccatactacccaacaaaccaagaatttaccactgtttcc
cttgaagaggctttgggcgatcgcctgaatgatactttatttgaactacgaatcgaaaat
gggaaaccacgccaagacttcaagagtcttcaaggacaattcaagctcatccattggcca
agtaaggtcgctatgtggacacacacaacacctctgccagattggggctacaaacaacaa
gaaattaacggaaataagaatttggctcaaagttcgaacatctggtatgtggatgagatc
ccatccattcctaaggactctccacgtttgatcaaggaggaacgcaaggttaagagtgta
ccattcttgaagaaatggttcgagctacaacgagctatgttctatcacaacaatgctttg
actagcagccatccatatgctagtgaaccttttgtttggccatttcttttgagaggtgtt
agtttctggacccagaatgacaccagacaacaaatctacttcctaggaaacccacttgga
tggtggttggcaagtagtttacttgcagtttatgccggaatctgggctgctgatcaattg
tccttgcgccgtggtgtcgatgcactggataaccgtacccgatcccgcctatataattcc
accggtttcttcttccttgcctgggcaacacattacctaccattttatctgatgggtcgt
caattgttcttgcatcattatttacctgcccacttggcatcatgcctgatcaccggagca
ttgctcgagttcattttcaacgtggagcctgtcttggacgatattccatcgggagctgcg
aagaaggcaggtgcagtcaagaagcacctcccagctcgcgaaaagctcgccggacaaaac
ttaatgatgtcctgggctgcagttgtagtcattctctccgttgtacttttcgggtggtat
tacttcttaccattgacgtatggctatccaggcctcagcgttcccgaagttaatgcaagg
aaatggctaggatacgatcttcatttcgccaaataa

DBGET integrated database retrieval system