KEGG   Sclerotinia sclerotiorum: SS1G_02262Help
Entry
SS1G_02262        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SS1G_02262
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SS1G_02262
Peptidases [BR:ssl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SS1G_02262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 743 aa AA seqDB search
MSPAAIGGPHLRATSINSTGPINTTRRNWINGVDNSKGESRVLPHLSDLVNAKPLVDRQS
SLRKLLEAGEEAAKQAETLLDFKRLDLALQQYIVAFTIAVEYIPQSPHYPDLRTRPDYPR
LYAGLQNRLNIQHSRFEEVKRLIKEDNARTGISPSNSFTHNGQPVPRNIDNSAFEPTMRD
VYSNAADRQLDTIDITKSSESRPKPTVQPKPQGLHGKSIQMANRISPTLSISSENDLATR
FARLRSSNNPAPIQDPRIRTQQITIPDGITVDRKSTNAVSLPKQNASILRPLGPREMPTS
LAIPLTTEKPILAELLNNLQYFGTIIYDHAYDRPLKRRPMLLAGGVDSWVDLVGSGALQG
AIHGNKSLPKTKKHDHHALGRVSIAREPRKTIVTKRTISRSRTLSATEEEKWDKALKECV
ETDDAPAQELAIDESRYARTTEEFMRRYPEISTVKQSMALPSKPRSLPLYDGSMISAPPT
RPPPALPRQRSSGISEKTPYKNYAMTGGNSSAPPRVEPGLCGLRNVTGSLCYMNTAIQIL
SASPAIRNLFIRFQYPCNPAIPKKQHEDSPPRQLMTRALRSLLQHMWCGKYDEIVPRMFQ
QYVHATAVAYKGNLGANPKLYASDNAEVHTPVTTYGSATQHDCGEFLGFLSDRIMDEQNI
NRDKSVKDVDFGATNIGVDFPEILDMGKYTWLSEKDDYSDQLPAEQKRPFLYDCYAVVQH
SGTPKSGHYWALAHRYASIPPPR
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagtccagcagccatcggtgggccccacttgcgagctacttcgatcaatagcactgga
ccgatcaacactacaagaagaaattggattaatggtgttgacaactcgaagggcgaaagt
cgagtgctaccgcatttgagcgacttggtaaatgcgaaaccccttgtcgatagacagtct
tcattacggaagttactggaggcaggcgaggaagctgcgaaacaagcggagacattgctc
gatttcaaacgtctggatttggctcttcaacagtacatcgtagcttttacaatagccgtg
gagtatattccccagagtccgcattaccctgacctaaggactagaccggactatcctcga
ctatacgctggcctacaaaacaggctcaacatacaacacagcagattcgaggaagttaag
aggttaattaaagaggataacgcaagaacgggaattagcccatccaattcatttacacat
aatggacaacccgttccaagaaatatcgacaatagtgcatttgagcctaccatgcgagat
gtatatagtaacgcagccgacaggcaacttgataccatagatatcacaaaaagcagcgaa
agccgtccaaagccaactgtacagccaaaaccacaagggctccatggcaagtcgatccag
atggcaaatcgtatatcgcccactctatccatttcatccgagaatgacctggccacacga
tttgcccgtctaagaagttcaaacaatccagcccctattcaagatcctaggattcggacg
caacaaatcactattccagatggaatcacagtagatcgaaaatcaacaaatgccgtatcg
ctgcccaagcaaaatgcgagcatattgcggcctctcggtccaagggaaatgccaacgagt
ttagcaatacctcttacgacagaaaaaccaattcttgccgaactcttgaataatttgcaa
tatttcggtacaattatttacgatcatgcttatgatcgtccattgaagcgacgaccaatg
ttacttgctggtggtgtagactcctgggtggacctcgttggatctggcgcgctgcaaggc
gcaattcacggcaataaatctctgcctaaaactaagaagcatgatcatcacgctttgggt
cgagtctccatagcacgtgaacctcggaaaaccatagtaacgaagagaacaatctctaga
tcgcggacattatcagcgacagaggaagaaaagtgggataaggcattaaaagaatgtgtt
gagactgacgatgcacctgctcaggaattagctatagacgaatcgcgttatgccagaacg
accgaggaatttatgagaagatacccagaaatttccacagtcaaacagtctatggcgttg
ccgtcaaagccgaggtcattgcctctttatgatggatcaatgatctcggccccaccaact
cgaccgccaccagctttaccaagacagagatctagtggtatttccgaaaagaccccctat
aagaattatgctatgacagggggaaactctagcgctcctccccgtgttgaacccggtcta
tgtggtctaagaaacgtcacggggagcctgtgctatatgaatactgccatccagatactc
agtgcctcgccggcaattaggaatttgtttattagatttcaatatccttgcaatcctgca
attccgaaaaagcaacacgaagacagccctccacggcaattaatgacccgggctcttcgc
agtttgttacaacatatgtggtgtggaaaatatgatgaaattgttccaagaatgtttcaa
caatatgtccatgcaactgctgttgcctataaaggtaatttaggcgccaaccccaaactt
tacgcaagtgacaatgcagaagtgcacacacctgttacaacttatgggagcgcaacacaa
catgattgcggcgaatttttaggattcctttctgatagaattatggatgaacagaatatc
aaccgtgacaaatctgttaaagatgtcgactttggggccacaaacattggagtagatttt
ccagagattcttgacatgggaaaatacacatggttatcagagaaagatgactattcagac
caacttcctgcagagcagaaacgtccattcttatatgattgttatgctgttgtacagcac
agtgggactcctaagtcgggtcactattgggcattagctcaccgttatgcttctataccg
ccgccaaggtag

DBGET integrated database retrieval system