KEGG   Sclerotinia sclerotiorum: SS1G_03171Help
Entry
SS1G_03171        CDS       T01071                                 

Definition
similar to cAMP-dependent protein kinase A
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SS1G_03171
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SS1G_03171
Protein kinases [BR:ssl01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   SS1G_03171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MAETTTAAAEERQFVAHFSQKQHVSSPKEIQQNSRDKELGASSGSLSVRDFELVRTLGTV
IKLKQVDHVNHERSVLADVAGHPFITTLITSFADHDSLYMLLDYCPGGEVFSYLRKAKRF
DENTARFYAAEIVLILEFLHEREGVAYRDMKPENLLLDAEGHIKLVDFGFAKRLGNRETY
TLCGTPEYLAPEVIQSKGHTTAVDWWALGILIYEFLTGYPPFWHSNPIEIYKQIVTKPVS
FPAEPAISSAAKDIIRQFCTVDRSHRLGNISGGAARVKDHPFFQGVIWEDVYYRKYRGPI
IPPLRYPGDAQNFDLYPDEKEGREPYTEELAAKWDDCFKEF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccacgacggctgcggctgaagaaagacaattcgtggctcatttcagtcag
aagcagcatgtttcctccccgaaagagatccagcaaaattcaagggataaagaattggga
gcaagttcagggagtttgagtgtgcgagattttgaattggtgagaacgttaggaactgtc
atcaaacttaaacaggttgatcatgtcaatcatgagcgttcggttcttgcagatgttgct
ggccatcctttcattactacattaattacttcttttgctgatcacgactcattgtatatg
ctactcgactactgccctggaggtgaagtattttcttatttacgaaaagccaaacgattc
gacgagaacacagcacgattttatgccgccgagatagttttgatccttgaatttttacat
gagcgggagggggttgcatatagagatatgaaaccagagaacctgttattggatgctgag
ggacatataaagctggttgattttggatttgcaaaacgtttgggaaacagggaaacatat
accttgtgtggtacaccagagtatcttgcgccagaggttattcaatcgaaaggccataca
acagctgttgactggtgggctttgggtatattgatttacgaattcttgacgggatatcca
ccgttttggcactcgaacccaatagagatttacaagcaaattgttaccaagccagtctct
ttccctgctgaacctgctatttcatctgccgcgaaagacatcattcgccaattttgcacg
gtcgatcgatcacatcgtctcggaaatatatctggtggcgcagcacgagttaaagatcat
ccattttttcagggagtgatctgggaagatgtatattacaggaaatatcgtggtccgatt
ataccccctttgagatatccaggcgatgctcaaaattttgatttatatcccgatgaaaaa
gaaggaagagaaccatacacagaggagctcgcggcaaaatgggacgattgtttcaaggaa
ttttag

DBGET integrated database retrieval system