KEGG   Sclerotinia sclerotiorum: SS1G_03198Help
Entry
SS1G_03198        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SS1G_03198
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     SS1G_03198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MAMTESFPQLESTAKQDKLTPLNAPSRIDKPKIRRRSSGLGGEIRAGDTGAPAFATVDIR
PPSSGTIKAQADRDRKKPFSKRRKAKTLLQQYKRYALKHTWVTPLAIIAVILCLYAVNPT
KSNPVHYFIFPAYELPPTAGAEPGAPIQYGKGPWDFALVSFYIVVLSFTREFIMQKFLRP
LARKSGLKSRAKQSRFMEQMYTAIYFGILGPCGLYVMSRTPVWYFNTRGMYEGFPHKTHE
GIFKFYYLFQAAYWAQQALVLCLGLEKPRKDYKELVGHHIVSLFLIGLSYRFHFTYMGLA
VYVTHDISDFFLATSKTLNYLDHPLVGPYFAFFIAAWIYLRHYLNLKILYSEFNEFKTVG
PYELNWETEQYKCELSHVISTALLASLQALNLFWLFYILRIAYRFVFMSIVEDDRSDNDE
NELAEEQRLDELTRQGVDVVAAKAILSEDAVPKIKLNGNSIKGRSSGMEFETDAITNRKE
NVK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaccgaatctttcccgcagctggaatcgacagcaaagcaggataaattaacg
cctctcaatgcgccgtctcgtattgacaaaccgaaaatacgacgtcgttctagtgggttg
ggtggagagatcagggctggagacacgggtgcgccggcttttgcaactgttgatattaga
ccgccttcatctggaacaattaaggcccaggcagatagggatcgaaagaaaccattttca
aaaaggcgaaaagcaaagacacttttgcagcagtataagagatatgcattgaagcacact
tgggttacacctctagcaatcatcgcagtcatcctctgcctttacgctgtcaacccaacc
aaatcgaatcccgtacactatttcattttccctgcttatgaactccctccaacggcaggt
gctgaaccgggagcaccaattcaatatggcaaaggaccgtgggattttgctctggtttct
ttctacattgtggttctatccttcactcgagaattcatcatgcagaaattcctccggcca
ttggctcgcaagagtggactgaagagtagggcaaaacaatcgagatttatggaacaaatg
tacactgctatatactttggtattcttggtccttgtggcttatacgtcatgagtcgaaca
ccagtctggtatttcaatacacgcggaatgtacgaggggttcccgcacaaaacacacgag
gggatttttaaattctattatttgttccaggctgcatactgggcgcagcaagctctagtt
ttatgtttgggtttggagaaacctaggaaggattataaagagttggtcggacatcatatt
gtgtctttgttccttattgggttgagctaccgtttccatttcacatatatgggattggca
gtttatgtcactcatgatatcagtgatttcttcctagctacatccaaaactctcaactac
ttagatcaccctcttgtagggccatacttcgcattcttcatcgccgcgtggatttacctc
cgacattaccttaatctcaaaatcctctattcagaatttaacgaattcaagaccgtagga
ccttatgaattgaactgggaaacggaacaatacaagtgtgagctctcgcacgtcatctct
acagctctccttgcaagtttgcaagctctcaatctcttctggttattctacatcctacgt
atcgcatatcgattcgtctttatgagtatagtcgaggatgatcgaagtgataatgatgag
aatgagttagcggaggaacagagattggatgaattgaccagacaaggagtggatgttgtg
gctgctaaggcgattttgtcggaagatgcagtgccaaagattaaattgaatggaaattcg
attaaggggaggagttcagggatggaatttgaaacggatgccattacgaatagaaaggaa
aatgttaaatag

DBGET integrated database retrieval system