KEGG   Sclerotinia sclerotiorum: SS1G_03210Help
Entry
SS1G_03210        CDS       T01071                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssl00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 574 aa AA seqDB search
MAPNNTSPLFASGRPSSSNSEERAAAEDDALLGNRRKSSYEAKRPGFWREIGLFTWAVVA
TAAVIVLGVLLSRSQQSPKKTKQNGKRNLIFMVSDGMGPASLSLTRSFRQFQGDLPINDI
LQLDQHFIGSSRTRSSSSLVTDSAAGATAFSCGRKSYNGAISMLPDHSPCGTVLEAAKRA
GYITGLVVTTDITDATPACFASHVDYRLQEDSIALQEVGEHPLGHRVVDLMLGGGRCHFL
PNTSESSCRADSRDVTKLAQDKYGWTYIDTRDDFDKLKLGKNVKLPLLGLFSDTDVPFEL
DRRNMNDIYPSLDEMARTALTALEAATKDSDKGFFLMIEGSRIDHAGHGNDPAAQVHEVL
AYDRAFRSVIDFLDESDTEGALVSTSDHETGGLSVARQLNPSYPQYLWYPEVLANASHSS
EYLSRALRAHIASEASTEGDAAYRRFVKEELVEGGLGVMDASDAEIDLIISNPALSAYAF
ADIISRRAQIGWSTHGHSAVDVNIYGYGADVLRGNHENIEVGKFLRDYLSVDVDAITTEL
NSKKASGQSVSVASEPDVPVFGQYEERLKKNLPQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaataataccagcccgctattcgcgtcagggcgaccttcttcctcgaattcc
gaggaaagagctgctgccgaagacgatgcccttcttggtaatcgacgaaagagttcctat
gaagcgaagagacctggattctggcgagagatcgggctctttacttgggctgttgtcgct
actgctgctgtcatcgtactgggcgttttactatcgcgaagccaacaatcccctaagaag
acgaagcaaaatgggaagcgcaatctcatttttatggtgagtgatggaatgggcccggca
tctttgagcttgacgagaagcttccgacaatttcaaggagatttacccatcaatgatatt
cttcaactcgatcaacatttcatcggatcatcccgcacgagatcaagcagcagtcttgtc
acagacagtgctgcaggagctacagcattcagttgtggaaggaagagctataacggtgct
atttctatgctgccagatcatagcccttgcgggactgtacttgaagctgcaaagagggct
ggctacataacgggcttggttgttacaacagatataacggatgcgactcccgcttgcttt
gcctcgcacgttgattaccgattgcaggaggactcgatagctttacaggaggttggcgag
caccctcttggacatcgagttgttgatttgatgctgggtggtggacgctgtcacttctta
cccaatacatcagaatcgagttgcagagctgatagtcgtgatgtcacaaaattggcgcaa
gacaaatatgggtggacttacatcgataccagagatgacttcgacaagttaaagctcgga
aagaatgttaagctgccgttgttaggcctcttttccgacactgacgttcctttcgagctt
gatagacggaacatgaatgatatctacccttctctcgatgaaatggcaagaacagctttg
accgcactcgaagccgcaacaaaagacagcgataaaggattcttccttatgatcgagggt
agtcgaattgatcatgctggccatggcaatgacccagctgcgcaagttcatgaagtactc
gcatacgatcgagctttccgaagtgtcattgatttcctggacgagagtgataccgaaggt
gccctagtttctactagtgaccacgaaaccgggggtttatctgttgccagacaactaaat
ccttcatacccacaatatttatggtaccccgaggtactagcaaatgcttcccattcttca
gaatatctttctcgagctttacgggctcacattgcttccgaggcatccaccgaaggagac
gctgcgtatagacgatttgtgaaagaggaactcgttgaggggggcctcggagtaatggac
gcaagcgatgcagaaatcgacctcataattagcaacccggctctttccgcttatgcattt
gctgatatcatcagccgcagagcacaaatcggctggtcaactcatggtcactctgccgtt
gatgttaatatttatggttatggtgctgatgtcctccgtggaaatcacgagaacattgaa
gttggcaagtttttgagggattatctcagtgtcgacgttgatgcaatcacaacagagcta
aacagcaagaaggctagtggtcaaagtgtctcagtcgcttcagagcctgatgttccggtt
ttcggacaatatgaggaaagactcaagaagaacctgccacaatag

DBGET integrated database retrieval system