KEGG   Sclerotinia sclerotiorum: SS1G_03225Help
Entry
SS1G_03225        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ssl  Sclerotinia sclerotiorum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SS1G_03225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1401 aa AA seqDB search
MAEQSSSLNEIQALHSDLLALSNSRLSNLERLAIELDAHIAAFRNLLNHKSRNEQSRKSI
EEGKVERDGQMYKINDDFKQGTYQLADELNLDEFEASQIFFDAQDDADATGRSILSCSII
RFHQRRKLLLDCLRLTLQQNAELESDSEQERELKAYLEHIITESTRSEPTTTTKNGAATS
IKTSNAPTFISRCISTMGDIRHWLQKISDKVSSLSVLGQPSQPDLLEIMEYQRHSLVKQH
ELLGVIILYLIKANHSVEGDFELLLGILKKADKYDNLLVHHFPALAAYIWRYGSPEGGST
IQDARALDKKISVKTDQNAWVLPYAHAAFRAWWLAEYSGWYVEHHDGLPHGINLEDEAKQ
RSQQFNEALKDGAFDFMLSLSADVKAATWSEPSRQGFRLWLQRKAPQLLSDSVSFSDFFE
NQFMEQLQTFIESFITNLPDVLRRLRIDEDEQRQLSHEHEHDLDLERFIVIISYAFDGRP
KAALEGFWDVPDGVLIGFMYWASRRASTPLVSAFCEMLQAISGDDECATAAHEFLLDESP
QAGKMKRAHALTWNQIFKELTFFTNKLRDQPVPQAQAYRHGKPNHDQAELEPESYIMLES
YLRLISQLSGEYLWTALDIWTSGGYVHNPSTQRNTAPPSYAPDAILRKFATGFEEPDAFI
LLLHALVLPYEEDSALRDGLPFPELLGASSRMPGIDPYVDFAVGQVFGSRMIDTAIKTHR
RTPVPNAAYASFEDGVLNHLTIIPDLGLYCSSGNPELVMASLKLLEKLSASPQLAAAPKA
GSRRIDRNKAIAALEENNAAEAISRSLLQEIEASIDEAQGPASDSPGLLWDDRDLADPEF
LDSTSASCLSNFLNQRAIVLQYTSAELRRIALSHLPSLKERMFNTLLGSTMVEENQQIDN
CSVFDLFDFMDIPLDQSIALGSLSWLKDIDISVCEEVHNDSPPLCNMVKLEELLTLRRSE
LAATKRLENPQDVTTFKNEAQLMFNYYFIDNKLKELQAARHKALQSWVQLLLVMVETMAY
DESTKIVFVLQTLQIILPRLENCLENAADAFELAKLTKALLFSLNLDSDAFKEGDLGQNL
SDKLFHVFELSLRAINAVGANGPLKELFYTISYHYLTGTSESEIHVSSEIDNPNNLDGGS
NRARPGDRAPASAPSRPGLRKPHSTQTVKLAGDRVIDIVCDDVLVGEQNCRIAALLLLGA
LVKNSKQENSNYIIESLNRLNFISILVHSIGDLGNALQETSREDAAIILSDFYARLALLV
HISQTRAGATAVLNSGLFHSILVSGLFSIDTDLEIDFNDSEAVSRHYSLLAAIMRVICCA
LVSRGLQNEQSLDQGRRFLADNRAAILAVLKKSAGLGTGNDSAEQSIVDISDSFMLLMTI
TRFVDFEEITIQKRPTLRSFT
NT seq 4206 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagtctagtagcttgaatgaaatccaagccttgcattcggacctccttgca
ctatcaaattctcgtctttcgaacctcgaacgattagcgattgaactcgatgctcatatc
gcagcttttcgtaaccttttgaaccacaagagccggaatgagcaaagtcggaagagtatc
gaggaggggaaagttgagcgagatggacagatgtataagatcaacgacgactttaagcag
ggaacatatcaactggcggacgaattgaatcttgatgagttcgaggcatcccaaatcttc
ttcgacgcacaagacgatgccgatgcgacagggcgctcaattttatcctgctctataatc
cgcttccatcagcgacgaaagctcttgttggattgtttgcggcttacacttcagcaaaac
gccgagttagagagcgactcggagcaggagagggaattgaaggcttacctggaacatatc
atcacggagtcgacccgtagtgaacctacaaccacaactaaaaatggagctgcaacttca
atcaaaacaagcaatgcgccaacatttatttcaagatgcatttctactatgggtgatatc
aggcattggctccagaagatttcggacaaagttagcagtttatctgtattgggacaacca
tcgcaaccggatcttttagaaatcatggagtatcagcgccacagtctggtcaaacaacat
gagttactcggcgttataatactctatttgataaaagcaaaccattctgtcgagggagat
ttcgagctgctcttggggattttgaagaaagcggataagtatgataatcttctggtgcat
cattttcccgctttggctgcttatatttggcgttatggttctccagaaggtgggtcgacg
atacaagatgcaagagcgctggataagaagatcagcgtaaaaaccgaccagaatgcatgg
gtgttaccttatgctcatgccgcattccgagcatggtggttggcggagtatagtggatgg
tatgtggaacaccatgacggactaccacatggcattaatctcgaagatgaggccaagcag
cgttctcagcagtttaatgaggctcttaaggatggggcttttgattttatgctgtctctt
tctgctgatgtcaaagccgcaacttggtccgaaccgtcacgccaaggttttcggttatgg
ctacagagaaaggcacctcagctgttgtctgattctgtatctttctcagatttttttgaa
aatcaatttatggagcaattacagacattcatcgaaagtttcataacgaatctaccagac
gtattgaggaggttgagaatagatgaggatgagcaacgtcaactcagtcatgagcatgag
cacgatctagatctggagcgattcatagttatcatttcttatgcctttgacggccgccca
aaggctgctttggaaggattttgggacgtcccagatggtgttttaatcggtttcatgtat
tgggcttcccgacgtgcatcgaccccgctggtttcggcattttgtgaaatgctccaggct
atctcaggtgatgatgagtgtgccactgctgcacacgaatttttgctcgacgaaagtcct
caggccggaaaaatgaagcgtgctcatgccctcacatggaatcaaatttttaaagagcta
acatttttcacaaataaacttcgagatcaaccggtaccacaagctcaagcatatcgtcat
gggaagccaaaccatgatcaagcagaattagagccagaatcttacatcatgctggagtcc
tatctccgcctcatatctcagctctcaggcgagtacttgtggactgctctcgatatatgg
acttctggtggatatgtccataatcccagcactcaaagaaacacagccccaccatcttat
gcacctgacgcaattctccggaagtttgctacgggctttgaagaaccggacgcgtttatt
ctgctactccatgcccttgtattaccttacgaagaagatagtgctttgcgagatggctta
ccattccccgaactcctcggagcttccagtcgcatgcctggaatagatccctacgttgat
ttcgcagtcggccaagtttttggatcaagaatgattgacactgctataaaaactcatcgc
cgcaccccggttccaaatgccgcctacgcatctttcgaggatggagtactgaatcacttg
actatcattcctgatttgggcttatactgtagctctggcaaccctgaattggtcatggca
tccctaaaactactcgagaagctttctgcatcaccacagcttgctgctgcccctaaggca
ggtagcagaaggattgatcgtaataaggcaattgctgcgttggaggaaaataatgcagcg
gaggctatctcacgctcactcctacaagagatagaagccagcattgacgaagcccaaggc
cctgcatccgattcgccggggttgttatgggatgaccgagatctcgcagatccagaattc
ttggattcaacttccgcctcctgcctttcaaactttttaaatcaacgggctattgtcttg
caatacacatctgctgagttacgccggatagcactcagtcatttgccttctttaaaggag
cggatgttcaatacattacttggatcgacaatggtggaagagaaccaacaaattgacaat
tgttccgtttttgaccttttcgacttcatggatattcctttggatcaatcaatagccctt
ggctcattatcttggctcaaggatattgatattagcgtctgtgaggaagtccataacgat
tcacctccattgtgcaacatggtgaaactcgaagagcttctgactttacgaagatctgag
ctcgctgctacgaagagacttgaaaaccctcaagacgtgactacattcaaaaatgaagcc
cagctcatgtttaactactacttcatcgataacaagttaaaggaactccaagcagctcga
cataaggcgctacagtcttgggttcagttattactcgtgatggtagagaccatggcttac
gacgagtcgaccaaaatagtatttgtgttgcagactctgcaaataatcctacccaggctg
gaaaactgccttgaaaatgcagctgacgcatttgagctagccaaactcactaaagccctc
ttgtttagtctcaacctggattctgacgctttcaaggaaggtgacttgggacaaaatcta
agtgacaaactctttcatgtgttcgaattgtcacttagagctatcaatgccgtcggtgcc
aacggtcctctgaaagagcttttctataccatcagctatcactatcttacaggaacgtcg
gaatccgagattcacgttagttctgagatagataacccaaataacctcgacggcggttcc
aatcgtgcccgcccaggcgatcgcgctccagcttcagctccttctcgtcccggattacgc
aaaccacatagcacacagacagtcaaattggcaggcgatcgagtaatagacatagtttgc
gacgatgtcttggttggcgagcaaaattgtcgaattgcggcattgctactcctcggcgcc
ttggtgaaaaattccaaacaagaaaactccaattacattattgagtctcttaatcgcctt
aattttataagtatccttgtacactccattggagacttgggaaatgctttacaagagaca
tcgcgcgaagatgcagctataatactatccgacttctatgcgagattggcactcctcgtt
cacatatcgcaaactcgcgccggagctaccgctgtacttaactccggcctgtttcactct
attttagtttcagggctgttttccatagataccgaccttgagattgatttcaatgactcg
gaggctgttagcagacattacagcttacttgcagcaataatgagagtaatctgttgtgct
cttgtgagtcgaggcctacaaaatgagcagagtttggaccaagggagaagatttctcgcc
gacaacagagctgccatcctagctgtacttaaaaagtctgctggacttggaactggtaat
gactccgcagagcaaagcattgttgatatatcggactcattcatgttactcatgactata
actcgttttgtcgattttgaggagataactattcagaaacggcctactctgagatcattt
acttga

DBGET integrated database retrieval system