KEGG   Sclerotinia sclerotiorum: SS1G_03362Help
Entry
SS1G_03362        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ssl04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MVLLKSLVFAGLATVATASSAVIDLIPSNFDQFAFEGKPALIEFFAPWCGHCKTLAPVYE
QLAQDFAFAKDKVTIAKVDADAEKSLGKKFGVQGFPTIKYFDGKSKTPEEYSGGRDIDSL
TDFITKKTGIKPKKAKAAPSAVEMLNDKSFKEQIGGDKDVIVAFTAPWCGHCKTLAPVWE
KVAQDFANEPNVLIAKVDAEAENSKATAKDQGVTSYPTIKFFPKGSTEPEAYSGGRSEKD
LVEFMNSKAGTHRAVGGGLDATAGTIEALDALVAKFTGGSSIAEVSAEATKAAQEYKEGA
QFKYAEYYVKVFDKLSKSDNYAAKELARLDGIIKKGGLAPEKLDEFTSKTNILRRFIEKA
TGKSEL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggttctcttaaaaagtctcgtgttcgccggcctcgccacagtagcaacggcatcctct
gccgtcatcgatctcattccttcgaattttgatcaatttgccttcgagggcaagccagca
ttaatcgaattctttgcaccatggtgcggacattgcaaaacccttgcaccggtttatgag
cagcttgctcaggactttgcatttgcaaaggacaaggtcacaattgcgaaagtcgacgcg
gatgccgagaagagcttgggaaagaaattcggcgttcaaggtttcccaaccatcaaatat
ttcgatggaaagagcaagaccccggaggaatatagtggaggcagagatattgatagcttg
acggatttcatcacaaagaagactggcattaagcccaagaaggcgaaggctgccccaagt
gctgttgagatgttgaacgataagtcattcaaggaacaaattggtggtgataaggatgtc
attgttgcttttactgcaccatggtgtggtcactgcaagactttggcaccagtctgggag
aaggtcgctcaagacttcgcgaatgaacctaatgtcctcatcgctaaggtcgatgccgaa
gcagaaaactccaaggccacagctaaggaccaaggcgtcacctcttaccccaccattaag
ttcttccccaagggaagcactgaacctgaagcatactctggtggacgttccgagaaggac
ctcgtcgaattcatgaacagcaaggcaggtacacaccgtgctgttggtggtggacttgat
gctactgccggtacaattgaagctttggatgctcttgtcgccaaattcaccggtggttca
agcattgccgaagtttccgcagaagctaccaaggctgcccaagaatacaaggagggtgct
caattcaagtatgcagagtactacgttaaggtcttcgacaagttgagcaagagcgataac
tacgccgccaaggagctcgctagattggatggtattatcaagaagggaggtttggcacca
gagaagttggatgagttcacaagcaagaccaacatcctgagaagattcatcgagaaggca
actggaaagtccgagttgtaa

DBGET integrated database retrieval system