KEGG   Sclerotinia sclerotiorum: SS1G_03387Help
Entry
SS1G_03387        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssl00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 587 aa AA seqDB search
MKTAAVLSVLSLAVESVYSQAAGYSQCGGSNWTGATTCVSGYVCQSQNAYYSQCLPGTGT
SVATTLTTATKSSTTSATSKSTTSTASSSKASSTAASTVQSACTAAFTPVTASAAFAALN
PGWNLGNTLDATPDEGSWNNPPVVPATFTAVKAEGFNSVRIPVTWAYHFVTSSPSWTVNT
TWMDRVETVVDQALATGMYVILNVHHDSWIWADVSASGANLTMIEEKFSALWSQIGTRMR
CKSSKLIFEPINEPPGTTQENANELNKLNNIFLAAINQAGGYNPQRVVALSGLQMNSVYT
EQWFAKPTTYTSQPWGLEFHYYSPYSFIYNAWGDTIWGSDADKAALTEDLQLFAGNFSGI
PTMIGEWQATPVIVAEPGARWRYTDYFVKTARSFGFAHVLWDNGLDFLDRNTNTWYDPIS
MSVLFNAAKGVSNSLPDGTVDTSATSQNTSAYIFHKVGDPVIAQSLPFLLNGNTLTSITT
SSGTTLATSSYSITSAGVLTFTQAYLSTLYSSTSTPGIKATLSLTFSAGSPSQIQVVQWA
TPTLSQTSFSKQTSSDLTIPINYAGLSEVAAVKALNADVFPENPRTK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggcggctgttttgagcgtgttgtccttggcagtagagtcagtgtactcccag
gctgccggatatagtcaatgtggtggaagcaactggacgggagcgactacttgcgttagt
ggatatgtctgtcaatctcaaaatgcgtattactcccaatgtcttcccgggacaggtact
tcagtagccacaactttgaccacggcaaccaagagcagcaccacatccgcgacctctaaa
tcaactacatccacagcttcatcctccaaagcgagctcgacggcagcctcaacggtgcaa
tcagcatgcactgcagcatttactccagttactgcttcagcagcatttgcagcattaaat
ccaggatggaatcttggaaacactctggatgctactccagatgaaggatcttggaacaac
cctcctgtcgtccctgctacattcacggcagttaaggccgagggattcaacagtgttaga
ataccagttacctgggcatatcactttgtaacatcttccccaagctggaccgttaacacc
acttggatggatcgcgttgaaacagtcgtcgatcaagcccttgctacgggcatgtacgtt
atcctcaatgtccaccacgactcctggatctgggccgatgtctctgcatctggagcaaac
cttaccatgatcgaagagaaattctctgctctttggtctcaaatcggaaccagaatgaga
tgcaaatctagtaaattgatctttgagccaatcaatgagccaccgggaacaacacaagaa
aatgccaacgaacttaataaactcaacaacatcttcctcgcggccatcaatcaagcagga
ggttacaaccctcaacgagtagtagccctttcaggtcttcaaatgaactcagtgtatact
gagcaatggtttgcaaagcccacaacctacacttctcaaccatggggtctcgaattccat
tattattcaccatacagtttcatctacaacgcttggggagataccatctggggttccgat
gccgataaagctgccctaacagaagatttgcaacttttcgcaggtaatttctcaggcatc
ccgacgatgattggagaatggcaagccacacctgtcattgtcgctgaacccggcgctaga
tggaggtacacagattactttgtgaaaaccgccaggagttttggtttcgcgcatgtactc
tgggacaatggactcgacttcttggaccgcaacacaaatacttggtatgatcctatctca
atgtctgtcctcttcaacgccgccaaaggagtctcaaactctctcccagatggcacggtt
gatacttccgccacatctcaaaatacctcggcatatattttccacaaagtcggtgatcca
gtcattgcacaatctcttccattccttctgaatgggaacaccttgacatccatcacaaca
tcttcgggaaccacactagcaacatcttcatacagcataacctctgctggagttctaact
ttcacgcaagcttacctctcaaccctctactcatccacatctacccccggcatcaaagcc
actctctcattaactttctccgcgggctcaccatcccaaatacaagttgtgcaatgggcc
actccaaccctctcacaaacctcctttagcaaacaaactagctccgatctcacaatcccc
attaactatgccggactgtcagaagtcgccgccgtcaaagctttgaatgcagatgttttt
cccgagaatcctaggacaaaatag

DBGET integrated database retrieval system