KEGG   Sclerotinia sclerotiorum: SS1G_03789Help
Entry
SS1G_03789        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SS1G_03789
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SS1G_03789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 259 aa AA seqDB search
MIGAVGDDEFGPSLISSLKSSLIDTTSVQTIPHQSTGVAVILVESDSGENRILLSPGANH
SLTPQTFTHTTSLGTPHPDLLILQLEIPLPSILQILTTATKNHIPVLLNPAPAQKLPPSA
YPSITHLILNETEAAILTSRPISSVASPTFDWRTVTSEFLSLGCKTVIITLGAKGAIFAT
GNTYEHIPAEKNVKVVDTTAAGDTFVGAYAVELVRNGDADVDALVAAVAKACKAAARTVE
KEGAQSAIPWADEVERSIL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgataggtgctgttggtgatgatgaattcggtccatccctcatctcctccctcaaatcc
tccctcatcgacacaacctccgtccaaaccatcccacaccaatccaccggcgtagcggta
atcctcgtcgaatccgacagcggcgaaaaccgcatcctcctctcccccggcgccaaccac
tctctaaccccccaaaccttcacccacaccacctccctcggcacaccccaccccgacctc
ctaatcctccaactcgagatccccctcccaagcatcctccaaatcctcaccacagccacc
aaaaaccacatcccagttctcctcaacccggcacccgctcaaaaactccccccctcagcc
tacccctccataacccacctaatcctcaacgaaaccgaagccgccatcctaacctctcgt
cccatctcctccgtcgcctcccctaccttcgattggcgcactgttacttcggaattttta
tccctcggctgtaagactgttataataacacttggagctaaaggcgcgatattcgctacg
gggaatacgtacgaacatattcctgcggagaaaaatgtaaaggtagttgatacgaccgct
gctggtgacacatttgtaggagcctatgctgttgagttagtgcggaatggggatgctgat
gtagatgctttggtagctgctgtggcgaaagcatgtaaggcggctgcgcgaactgtggag
aaagaaggggctcagagtgctatcccttgggctgatgaagtggagagatcgatcttgtaa

DBGET integrated database retrieval system