KEGG   Sclerotinia sclerotiorum: SS1G_04073Help
Entry
SS1G_04073        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ssl  Sclerotinia sclerotiorum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SS1G_04073
Translation factors [BR:ssl03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SS1G_04073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 272 aa AA seqDB search
MPDKWDEESSSEESSDPTPAQAAASTRRKFDDEEDDDEVLDSWSAAEDSEVEREKAKVEA
ERKAKADALAAANKKSKKERVAEKQAERARQLAENSDESSEDEATRRERLRRTEQESDLK
HAEDLFGNIGINSRKSTSAANAVQVDEKNPAATVDLTTLPLFDPRTKPQFEKLRETLVPL
ITNNVKKAQYIIFLQEFTKQISKDLPSDQIKKIASTLTALSNEKMKEEKAAEKGGKKSKA
QKTKTTLNASRDAISHKDTQAYDDDFGDDDFM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaagtgggatgaggaatcctcctccgaggagtcatccgatccaacgcccgca
caagctgccgcttcgacccgaagaaagtttgacgatgaagaggatgacgatgaagtctta
gattcctggagtgctgccgaggactctgaagttgaacgcgagaaggcaaaggtcgaagcc
gagagaaaagcaaaggctgatgcattggctgccgcgaacaagaagtcgaaaaaggaacgt
gtcgctgaaaagcaggccgagagagcacgtcaactcgcagaaaatagcgacgagagcagt
gaagatgaggctacaagaagagaacgccttagacgaactgaacaagaatccgacttgaag
cacgctgaggacctttttggcaacatcggtatcaactctcgcaagtctacaagtgctgca
aacgcggtgcaagttgatgagaagaaccccgcagccactgttgatttgacaactctccca
cttttcgatccaagaaccaagccccaatttgagaagctccgagaaactcttgtccctctc
attaccaataacgtcaagaaggcacaatatatcattttcttgcaagaattcaccaaacag
atctctaaagatcttcccagtgatcaaattaagaagatcgctagtacgttgacggccttg
agtaacgagaaaatgaaggaggagaaggcagctgaaaagggaggaaagaagtccaaagca
caaaaaaccaagactaccttgaatgcaagcagagatgccatctcccataaagatacccag
gcttatgacgatgattttggagatgatgattttatgtga

DBGET integrated database retrieval system