KEGG   Sclerotinia sclerotiorum: SS1G_04180Help
Entry
SS1G_04180        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_04180
Enzymes [BR:ssl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SS1G_04180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MDRPKKPSALSATPALTPHPQINTTHSNSRVSAVLPTGESIEILLYGATIISWKDAAGTE
KLWLSEKAALDGTKAVRGGIPLVFPVFGKVEGEEGKAKGVDTLPQHGFARNCRWEFLGKS
TSESTLKGQEGGSSVKLDFGLSASNLPEETRKLWGGEFGLIYSVTLGKESLGTSMVVRNE
GTTAWEFQILMHTYLKIQDISQISINGLENATYVDKLTEPISTNTAPSEPLTISAKTDRV
YTPAGGPSTEIIVSEGGKKKYTVARDNMNQVVVWNPWIDAKDIGDFAPKDGWRTMICVEA
GSVTGWQKLEAGETWEGGQIITLAN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaccgacccaagaagccatccgctctctctgccactccagctctcacaccccatcct
caaataaacactacacattccaattcacgcgtctcggccgtcctccccaccggtgaatca
attgaaatccttctctacggcgccacaatcataagctggaaagatgccgccggaaccgaa
aaactctggcttagcgaaaaagctgcactcgatggtacaaaagcggtgcgcggtggtatt
ccactagtattcccggtatttggaaaagtcgagggtgaggaaggtaaggcgaaaggtgtt
gatactttacctcaacatggttttgcgcgcaattgcagatgggagtttttgggaaagagt
acaagtgagagtactcttaagggacaggagggtggtagcagtgtcaaattggattttggt
ttgagtgctagtaatctaccagaggagaccaggaagctatggggtggtgaatttggtctg
atttatagtgttactcttggtaaagagagtttgggaacgagtatggtggttaggaatgag
ggtaccacagcctgggagtttcaaatcttgatgcacacttatttgaagattcaggatatt
tcccaaatctccatcaatggtctcgagaatgcaacttatgttgacaaactcaccgaacca
atttccacaaatactgctccttccgaacctcttaccatctctgctaaaaccgatcgtgtc
tacactccagctggtggtccatctaccgaaattattgtttctgaaggaggaaagaagaaa
tacacagttgctagagataacatgaatcaagtcgttgtatggaacccttggattgacgcc
aaagatatcggagattttgctccaaaagatggatggagaacaatgatttgtgtcgaggct
ggatctgttactggatggcaaaaattggaagctggtgaaacttgggaaggtggtcaaatt
attacacttgctaattag

DBGET integrated database retrieval system