KEGG   Sclerotinia sclerotiorum: SS1G_04242Help
Entry
SS1G_04242        CDS       T01071                                 

Definition
similar to UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SS1G_04242
   00052 Galactose metabolism
    SS1G_04242
   00500 Starch and sucrose metabolism
    SS1G_04242
   00520 Amino sugar and nucleotide sugar metabolism
    SS1G_04242
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SS1G_04242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 525 aa AA seqDB search
MAQALKSALPSHLKPSSLSPNDNGEFARKHHGKTQSHMAFENTSTSVAASQMRNALNSLA
DTVSDPEEKKLFETEMDNFFALFRRYLNDKAKGNQLDWDRIAPPAQNQVVDYNELANSES
VGFLNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYNVNVPFVL
MNSFNTDDDTSSIIKKYEGHNIDILTFNQSRYPRILKDSLLPAPKSFDSPISDWYPPGHG
DVFESLYNSGILDTLIKRGVEIVFLSNVDNLGAVVDLRILQHMVETKAEYIMELTDKTKA
DVKGGTIIDYEGSVRLLEIAQVPKEHTNEFKSIKKFKYFNTNNIWLNLQAVKRIVENNEL
EMEIIPNNKSIPADKKGESDVSIVQLETAVGAAIRHFHNAHGVNVPRRRFLPVKTCSDLM
LVKSDLYSLKHGQLQIDPSRFGPAPLIKLGNDFKKVSDFQKRISSIPRILELDHLTITGA
VNLGRGVTLKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagctttgaaaagcgctctcccctcccacctcaagccatcgagcttatctcca
aacgataacggcgaattcgcccgcaagcaccatggcaagacacaatcacacatggctttc
gaaaacacctcaacatctgtagctgccagtcagatgcgaaatgctctcaacagcctggca
gacaccgtctcagaccccgaagagaagaagctcttcgagactgagatggacaacttcttc
gctcttttccgcagatacttaaatgacaaggcaaagggaaaccagcttgactgggaccgt
attgccccacccgcccagaaccaagtcgtcgattacaatgagcttgcaaactccgagtct
gttggattccttaacaaattggctgtcctcaagcttaatggtggtcttggtacttccatg
ggttgtgttggtcccaaatcagttattgaggtccgtgatggcatgtccttcctcgatctt
tccgtccgacaaatcgaataccttaaccgcacatacaacgttaatgttcctttcgtgttg
atgaactcattcaacactgatgatgatacctcaagcattatcaagaaatatgagggacac
aacattgacattctaacattcaaccaatctcgatacccaagaatcttgaaggactcgctc
cttcctgcaccaaagtctttcgactcaccaatttctgactggtacccaccaggacacgga
gatgttttcgagtctctctacaactctggcatccttgacactctcatcaagcgaggtgtt
gagattgttttcctttccaacgttgacaacttgggtgctgttgtcgatcttcgcatcttg
cagcacatggttgagaccaaggctgagtacatcatggagttgactgacaagaccaaggcc
gatgttaagggtggtaccatcatcgattatgaaggttctgtccgtctcctcgaaattgct
caagtaccaaaagagcataccaacgagttcaaatctatcaagaaattcaagtacttcaac
accaacaacatctggttgaacttgcaagctgtcaagcgcattgtcgagaacaacgagctc
gagatggaaatcatcccaaacaacaaatccatcccagctgacaagaagggcgagtctgat
gtctcaatcgttcagctcgaaactgccgtcggagctgccatccgtcatttccacaacgcc
catggtgtcaatgtgccccgtagacgtttcttgccagtcaagacctgctctgacttgatg
cttgtcaagtcggacttatactcattgaagcacggtcaactccaaattgaccccagccgt
ttcggtccagctcctttgatcaagctcggtaacgatttcaagaaggtttctgacttccag
aagcgtatcagcagcattccaagaatcctcgagcttgatcacttgaccatcactggtgct
gttaaccttggcagaggtgttaccctcaagggtaccgttatcattgtagcaactgagggg
caaactatcgatattcctcccggatccatcttggagaatgttgtggttcaaggatccttg
agactgttggagcattaa

DBGET integrated database retrieval system