KEGG   Sclerotinia sclerotiorum: SS1G_04242Help
Entry
SS1G_04242        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00040  Pentose and glucuronate interconversions
ssl00052  Galactose metabolism
ssl00500  Starch and sucrose metabolism
ssl00520  Amino sugar and nucleotide sugar metabolism
ssl01100  Metabolic pathways
ssl01130  Biosynthesis of antibiotics
Module
ssl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SS1G_04242
   00052 Galactose metabolism
    SS1G_04242
   00500 Starch and sucrose metabolism
    SS1G_04242
   00520 Amino sugar and nucleotide sugar metabolism
    SS1G_04242
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SS1G_04242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP PilO
Motif
Other DBs
NCBI-GeneID: 5490983
NCBI-ProteinID: XP_001594435
UniProt: A0A1D9PWH2 A7EG01
Position
Unknown
AA seq 525 aa AA seqDB search
MAQALKSALPSHLKPSSLSPNDNGEFARKHHGKTQSHMAFENTSTSVAASQMRNALNSLA
DTVSDPEEKKLFETEMDNFFALFRRYLNDKAKGNQLDWDRIAPPAQNQVVDYNELANSES
VGFLNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYNVNVPFVL
MNSFNTDDDTSSIIKKYEGHNIDILTFNQSRYPRILKDSLLPAPKSFDSPISDWYPPGHG
DVFESLYNSGILDTLIKRGVEIVFLSNVDNLGAVVDLRILQHMVETKAEYIMELTDKTKA
DVKGGTIIDYEGSVRLLEIAQVPKEHTNEFKSIKKFKYFNTNNIWLNLQAVKRIVENNEL
EMEIIPNNKSIPADKKGESDVSIVQLETAVGAAIRHFHNAHGVNVPRRRFLPVKTCSDLM
LVKSDLYSLKHGQLQIDPSRFGPAPLIKLGNDFKKVSDFQKRISSIPRILELDHLTITGA
VNLGRGVTLKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagctttgaaaagcgctctcccctcccacctcaagccatcgagcttatctcca
aacgataacggcgaattcgcccgcaagcaccatggcaagacacaatcacacatggctttc
gaaaacacctcaacatctgtagctgccagtcagatgcgaaatgctctcaacagcctggca
gacaccgtctcagaccccgaagagaagaagctcttcgagactgagatggacaacttcttc
gctcttttccgcagatacttaaatgacaaggcaaagggaaaccagcttgactgggaccgt
attgccccacccgcccagaaccaagtcgtcgattacaatgagcttgcaaactccgagtct
gttggattccttaacaaattggctgtcctcaagcttaatggtggtcttggtacttccatg
ggttgtgttggtcccaaatcagttattgaggtccgtgatggcatgtccttcctcgatctt
tccgtccgacaaatcgaataccttaaccgcacatacaacgttaatgttcctttcgtgttg
atgaactcattcaacactgatgatgatacctcaagcattatcaagaaatatgagggacac
aacattgacattctaacattcaaccaatctcgatacccaagaatcttgaaggactcgctc
cttcctgcaccaaagtctttcgactcaccaatttctgactggtacccaccaggacacgga
gatgttttcgagtctctctacaactctggcatccttgacactctcatcaagcgaggtgtt
gagattgttttcctttccaacgttgacaacttgggtgctgttgtcgatcttcgcatcttg
cagcacatggttgagaccaaggctgagtacatcatggagttgactgacaagaccaaggcc
gatgttaagggtggtaccatcatcgattatgaaggttctgtccgtctcctcgaaattgct
caagtaccaaaagagcataccaacgagttcaaatctatcaagaaattcaagtacttcaac
accaacaacatctggttgaacttgcaagctgtcaagcgcattgtcgagaacaacgagctc
gagatggaaatcatcccaaacaacaaatccatcccagctgacaagaagggcgagtctgat
gtctcaatcgttcagctcgaaactgccgtcggagctgccatccgtcatttccacaacgcc
catggtgtcaatgtgccccgtagacgtttcttgccagtcaagacctgctctgacttgatg
cttgtcaagtcggacttatactcattgaagcacggtcaactccaaattgaccccagccgt
ttcggtccagctcctttgatcaagctcggtaacgatttcaagaaggtttctgacttccag
aagcgtatcagcagcattccaagaatcctcgagcttgatcacttgaccatcactggtgct
gttaaccttggcagaggtgttaccctcaagggtaccgttatcattgtagcaactgagggg
caaactatcgatattcctcccggatccatcttggagaatgttgtggttcaaggatccttg
agactgttggagcattaa

DBGET integrated database retrieval system