KEGG   Sclerotinia sclerotiorum: SS1G_04596Help
Entry
SS1G_04596        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SS1G_04596
  Replication and repair
   03420 Nucleotide excision repair
    SS1G_04596
Transcription machinery [BR:ssl03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SS1G_04596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 420 aa AA seqDB search
MPKPLPLTALDQWVQPKSKRQKDQALSLLSRLHIVDITALSREDPQTVALTKSFGTSLRL
ALTGGGNHQSFGVPSSDHIAPHVDIDFLDVHARMQWEGILHYMVNNVAAGSGQEGSGPAG
SVKKLLDAGKLVTRGRSVGITQAGFSFLLQEANAQVWTLLLLWIENAESMGMDSVDVLSF
LFMLGSLELGRAYSTTTLTDAQHNMLGNLIDFGLIYLPPSAPTQFFPTRLATTLTSDASA
LRTVSAGFDAASKSAANQKGFIIIETNYRLYAYTNSPLQIAVLSLFTKLNTRYPNMVSGR
VSRDSIRTAISHGITSDQIITYLSTHAHPQLVKASTAAHGGPVLPPTVVDQIRLWQLENE
RMKAVPGFLFKEFDGQKEYEGCAKYAEEVGVLVWKNDAKRMFFVTRVEQLRDYIKARKIK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcctttacctctcacagctctggatcaatgggtgcaaccgaagagcaagagg
caaaaagatcaagccctatccttactatcgcgactgcatattgtcgatattactgcgctg
agccgagaagatcctcagactgtagctctgactaaaagtttcggaacttctttacgactg
gcacttactggtggagggaatcatcaatcttttggagttccttcgtcggatcacattgcg
ccacacgttgatatagatttcttggatgtacatgctcgaatgcaatgggaggggattcta
cattatatggtcaataatgttgcagcaggttccgggcaggaaggaagtgggcccgcaggt
tcagttaagaaactactcgatgcaggaaagttagttacaagagggcgaagtgtgggtatc
actcaagctggattctcatttttattacaagaagccaatgcgcaagtctggactttactt
cttttatggattgaaaatgctgagagtatgggaatggattccgttgatgtactctctttc
ctattcatgctaggttcccttgaactcggacgtgcatatagcaccacaaccctcacagat
gctcaacacaatatgctcggcaacctcatcgactttggcctgatttacctccctccttcc
gctcccacacagttcttcccaactcgtcttgctacgaccctcacctcagacgccagcgct
cttcgtaccgtgtcagccggtttcgatgccgcttccaaatccgccgctaaccaaaagggc
ttcataattattgaaaccaactaccgcttatacgcctacacaaattctccgcttcaaatt
gccgtcctctcactctttaccaaacttaacactcgataccccaacatggtcagcggccgc
gtctctcgtgattccatacgtactgccatatctcacggtatcacttccgatcaaataatc
acctacttatccacccatgcgcacccgcaactcgtcaaagcctctactgcagctcatgga
ggaccagtattaccacctacggtcgttgatcaaattcgtctctggcaattggaaaacgag
agaatgaaagcagtgccggggtttttgttcaaggaatttgacgggcagaaggagtatgaa
gggtgtgcgaaatatgccgaagaagtaggagtattggtttggaagaatgatgcgaagagg
atgtttttcgtaacgagggtggagcagttgagggattatattaaagcgaggaagataaaa
tag

DBGET integrated database retrieval system