KEGG   Sclerotinia sclerotiorum: SS1G_04707Help
Entry
SS1G_04707        CDS       T01071                                 

Definition
translation Initiation Factor Eif4e
Orthology
K03259  
translation initiation factor 4E
Organism
ssl  Sclerotinia sclerotiorum
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ssl03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 256 aa AA seqDB search
MAAVAAPAGEQVDLSTIPISPEGASNSNENTKPATDGEQITVFHDKDNFNVKHPLMNKWT
LWFTKPPSGKGDNWNDLLKEVITFNSVEEFWGVYNNIAPTSELALKSDYHLFKEGVRPEW
EDQQNKHGGKWSYQFKEKRNVPIDELWLHVMLAAIGETLEEEDDGEVMGVVVNVRKGFYR
VGVWTRTIGKSIPGGGDGDVAGGKGRSTEKGKEILMNIGKKFKEVLKLPASEPVEFSGHT
DSAHSGSTRAKAKYSV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtcgcagcaccagctggtgaacaagttgacttgtcaaccatcccaatctca
cctgaaggcgccagcaattcgaacgagaacaccaaaccagctaccgatggcgaacaaatt
accgtctttcatgacaaagataacttcaatgttaagcatcctttgatgaacaaatggact
ttgtggtttacaaagccacctagtggaaagggtgataactggaatgatcttttgaaggaa
gttatcacattcaactccgtcgaggaattctggggtgtctataacaacattgcaccaact
tctgaactcgctctcaagtccgattaccatcttttcaaggaaggagttcgaccagaatgg
gaggatcaacaaaacaaacatggaggaaagtggtcatatcaattcaaggagaagcgcaac
gtccccattgacgaactatggcttcatgtcatgttagcagctattggagagactctcgag
gaagaggatgatggagaggtgatgggtgtcgttgtcaacgtgagaaaaggattctaccgt
gttggtgtatggactcgcacaatcggcaagagtattccgggaggtggagatggtgatgtc
gctggaggcaagggaagatccaccgaaaaaggaaaagagatcttgatgaacatcggcaaa
aagttcaaggaagtcttgaagctcccagcatcagagccagtcgaattttctggtcacacc
gatagtgcacacagcggcagcactcgtgccaaggccaagtattcagtctag

DBGET integrated database retrieval system