KEGG   Sclerotinia sclerotiorum: SS1G_04820Help
Entry
SS1G_04820        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ssl  Sclerotinia sclerotiorum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SS1G_04820
Translation factors [BR:ssl03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SS1G_04820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 744 aa AA seqDB search
MAPSFDHLPDPEEDEYDEEELDISDLRERFEVQLEQGLDTFVVIDGLPEVNEDTKPKLIK
FLLRKLDSVGQTKKDSIHMPIGPDGKSFKFAFVEYSSPAEAIAACKALDGVPLDKKHTLR
VNKLTDIDRYGREGRIDENYTPPKIEEFTEKEHLRSWLADPAGRGRDQFVMYKDDRVQVF
WNNEKDAPESIVDRQHWTESFVQWSPQGTFLTSMHQQGVQLWGGPSWTRQKRFAHPFVNL
VDFSPGEKYLTTWSNRPISIGEEGHPALSVDDDGKNYVIWDIETGLPLRSFANLDLPSNS
VDAEGNPVKRKIQWPAFKWSSDDKYVARLTQGSSISVYELPRMNLLDKTSIKIDGVMDFD
WAPATPHREGVKNYEQLFCYWTPEIGSNPAKVGLMSIPSKEVVRTLNLFSVTDAKLHWQS
DASYLCVKVDRHSKSKKSLATSLEIFRVKEKGVPVEVVDSIKDTVINFAWEPKGDRFVII
TTAEVVAATAVPPKTSVSFFCPEKVKGNGVGNFKHIRTYDKKNSNAIYWSPKGRFVIVAT
VHSQQSFDMEFYDMDFEGEKPESDKDLTANLQLMNTADHYGVTDIDWDPTGRFVATSASI
WKHTMENGYHLYDFKGEQLREEPVEKFKQWLWRPRPPTLLSKEEQKQIRKNLREYSKVFD
QEDADRGASADLAVVEHRRRLLDEWLAWRANIEEDVQAEREDAGLPRDPLEPLKSKMASG
DEGQAIEIEEIVEEIVEETEEIIS
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagttttgaccatctcccagatcccgaggaggacgagtatgatgaggaggag
ctcgatatttccgatctaagagaacgtttcgaggttcaacttgaacaaggactcgacact
tttgttgttattgatggccttccagaagttaacgaggataccaagccaaagctgattaag
ttcttgttgagaaaattggactctgttggtcaaacaaaaaaggactcaatacatatgccc
atcggtccagatggcaaatcgttcaaatttgctttcgtcgaatactcgtcccctgctgag
gctatcgctgcatgcaaagccctcgacggcgtacccctcgacaaaaaacacactctccga
gtcaacaaattgacagatattgatcgctatggtcgtgaaggacgtatcgacgaaaactac
acccctccaaaaattgaagagttcaccgagaaggagcatttgagatcatggctcgcggat
ccagctggacgtggacgtgatcaattcgtcatgtataaggatgatcgagtacaagttttc
tggaacaacgagaaggatgcaccagagagcatcgtcgatcgccaacactggaccgagtcg
ttcgtacaatggtcaccacaaggtactttcttgacttcgatgcatcagcaaggtgtacaa
ctttggggtgggccatcttggactagacaaaagcgtttcgcgcatccattcgtcaacctc
gtcgacttttcgccaggagagaaatacctcacaacatggtcaaatcgaccaattagcatt
ggcgaggaaggccacccagctctatcggttgatgatgatgggaagaactatgttatttgg
gatatcgagacaggcttgccgttgcgttcattcgctaacctcgatttaccaagcaatagc
gttgatgcagaaggtaaccctgtgaagagaaagattcaatggccagctttcaagtggtca
tcagatgacaaatatgttgctcgtttgactcaaggctcatcgatctccgtctatgaatta
cccagaatgaacctcttggacaaaacctctatcaaaatcgatggggtgatggacttcgac
tgggcaccagccacccctcaccgtgagggtgtcaagaactatgagcagctgttctgctat
tggacccctgaaattggcagcaacccagcgaaggttggattaatgagcattccgtctaaa
gaagtagtccgaactttgaaccttttcagcgtgacagatgcaaagcttcactggcaatca
gatgcctcatatttgtgtgtgaaggttgatagacattcaaagtcaaagaagtctctggca
accagtttggagatcttccgtgtaaaagaaaagggggtacccgttgaggttgtcgattca
atcaaagacactgtcatcaacttcgcctgggagccaaagggtgaccgtttcgttatcatc
acaaccgcagaagtcgttgcagccacagccgttccacctaagacatccgtttccttcttt
tgtccagaaaaggtcaagggcaatggcgttggtaacttcaagcacatccgcacatatgac
aaaaagaacagcaatgccatctactggtctccaaagggtagatttgtcattgtggctaca
gttcactctcaacaaagtttcgacatggagttttatgatatggactttgagggcgagaaa
cccgaaagtgacaaggatctgacagccaatttacaactcatgaacaccgccgatcattat
ggtgtaacagatatcgattgggatcccacaggacggttcgttgctacaagtgccagtatt
tggaagcacaccatggagaacggttaccacttgtacgactttaagggtgagcagcttcga
gaagaaccagtcgagaagttcaagcaatggttatggcgccctcgaccacctactctactc
agtaaagaagaacaaaagcaaatccgcaagaatctccgtgaatacagcaaagtattcgac
caagaagatgccgatcgtggcgcatccgccgatcttgccgttgtcgaacacagacgcaga
ctcttggacgagtggcttgcatggagggctaatatcgaagaggatgttcaggccgagaga
gaagatgcaggccttcctcgtgatcctctggagcctctcaaatctaaaatggcaagtggt
gatgaaggacaagccatcgagattgaggagattgttgaagagattgtcgaggagactgag
gagattatatcataa

DBGET integrated database retrieval system