KEGG   Sclerotinia sclerotiorum: SS1G_04855Help
Entry
SS1G_04855        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ssl  Sclerotinia sclerotiorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 885 aa AA seqDB search
MNGRHLPAGQGMQQDMGRRRPYSHQAQPYPPAAPLYNGYMHPYNANYYPQPFPPQYHNPA
ITQQYNPYQHYGRSPPPMMPHYVHPPPPPLQPQAPPFTRPQPSPAIAASHPPVIASSYQP
ASAPVPPQTPSTYSTQSSNTLPGPMTPPTPQALPQSPPPAPNHYMPFQPPLPWATPNTAA
PWPARRRRKRKQSPEISTNPVELPDLDKDVVSEPEKDLERLETRIEPTPAVEEASGLAPE
TPTTTQGPSEDNESTISSTPSSTQPSSLPTGGQATPVATKSQRAAVPAVPVVRVIPKSQP
KNTPSTTPQKPSGELPAEVTPGTSEPTNADEAKEPANEEVKTTPPPPKAWATPRAWTGLF
GSSGAPTAPTTANGGQNGSPGFGKKNTESLAEALRSFNAEAKDSKIAFLEPRGLVNTGNM
CYMNSVLQVLVFCTPFYDFLDQVSKKAAHSFKSETPLIDAMIMFMREFPVIDSAKSVEQL
KMRLKEGELEQYGDSFTPDFVYDVMRRLPRFVTMQRGHQQDAEEFLGFLLEGLHDECVHV
MKSSDSSKTPAATTPMNAPSSPTSDSASRRGSIDDVWQQVGPKQKAAITRSSGTILTGSP
VTKIFGGSLRSELRVPGLKDSITLEPYQPLQLDIGSPNIHNIIDALKGLTHSEVLHGDFK
SPKGPNVTATKQVFIETVPPVLILHLKRFQYDNTGGTQKIWKKVGYPLELELPKEVFPKT
KRGVFAHDGYPKYRLIGVVYHHGKNASGGHYTVDVRRQDGKEWIRLDDTVIKRVRSEDVA
EGGSEEDPKVLAAALEAHKKDSSSSGNIFSSIGEENGEAEEDGWKQASGSGKKWSSVVNG
ASTPKPKSANGHGAEMIGAEGAIPVRKSDILMSLFSNRISDGWFA
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtcgtcatctgccggcagggcaaggcatgcaacaagatatgggaaggagaaga
ccttatagtcatcaggctcagccatatccgccggcggcacctttgtacaatggatacatg
cacccgtacaacgcgaactattacccacaaccatttcctccacaatatcataatccagct
atcacccaacagtacaatccttatcaacattatggtcgttcgcctcctccaatgatgccg
cattatgttcatcctcctccacctccacttcaaccccaagcaccaccttttactcgaccc
caaccatctcctgctattgccgcatctcatccaccagtgatcgcgtcgtcttatcaacca
gcctctgcgccagtcccccctcagactccttcaacctactcaacgcagtcatccaatact
cttcctggacctatgacacctcctactccacaagcattacctcaatctccacctccagcc
cctaaccactatatgcctttccagccaccattgccttgggctactcctaatactgctgca
ccctggccagccagacggcgtcggaaaagaaagcagagtcctgaaatatctacgaatcct
gtcgagcttccagacttagacaaagatgttgtttctgagccggagaaggatttagaaagg
ttggaaacacgtatagaaccaacaccggcggttgaagaagcttcagggcttgcacccgaa
acacctaccactactcaaggtccatccgaagacaatgaatctacaatatcatctacacca
tcatctacacaaccttcgtctctccctaccggtgggcaggcgactcctgtagccacgaaa
tcccagcgagctgccgtacctgctgtccccgtcgtacgtgtcatcccaaagtctcagcct
aaaaatacgccatcgacgacccctcaaaagcccagcggagaacttcctgccgaggtgacc
ccgggtacatccgaacccacaaatgcggatgaagcgaaagagcctgctaatgaagaggtt
aagacaacaccccctcctcctaaagcatgggctactccaagagcttggactggtctcttt
ggttcatccggtgcacctacagcacctaccactgccaatggtgggcaaaatggatcaccc
ggatttggcaagaagaatacggaatcattggctgaagcattgcgctcgttcaatgctgaa
gctaaagactctaaaatagcatttcttgagcctcgaggtttagttaacactggtaatatg
tgctacatgaactcagttttacaagttcttgttttctgtacccctttctatgactttctt
gaccaagttagcaagaaagcagcgcatagcttcaagagtgaaactcctttgattgatgcc
atgattatgtttatgcgagagtttccagtaattgattctgcaaaatctgttgagcaactc
aaaatgagattaaaggaaggagaacttgagcaatatggagactcttttacaccggacttt
gtatacgatgtcatgcgacgcttaccaagattcgtgacgatgcagagaggacatcaacaa
gatgcggaggaatttctaggcttcttacttgaaggccttcatgatgaatgtgtacatgtc
atgaagtcaagtgactcgagcaaaactccggctgccacaacacccatgaatgcaccttca
tccccaacaagcgactctgccagtcgacgcggatctattgatgatgtctggcagcaggtt
ggacctaaacaaaaggctgcgatcacaaggtcttccgggaccatcctgactggctctcca
gtcactaagatttttggtggcagcttaagatctgaattgcgtgtgccaggcttgaaagat
tccatcactcttgagccatatcaaccactacaacttgatattggttcaccaaacattcac
aatatcattgatgcattgaaaggtttaacacattccgaggtccttcatggcgatttcaag
tctccaaagggtcccaatgtgaccgcgacaaagcaggtattcattgagacagtacctcct
gttctcatcttacacttgaagcgtttccagtatgacaacactggcggaacgcagaagatt
tggaagaaggtcggatatcctttggaactcgaattaccaaaggaagtctttcccaaaact
aaacgaggtgtcttcgctcatgatggttatccgaagtatcgtctcatcggcgtcgtgtat
catcatggtaagaatgccagcggtggacactatactgtggatgttagaaggcaagatggg
aaagagtggatcagacttgacgacactgttattaaacgtgtaagaagcgaagatgtggct
gaaggaggtagtgaggaagaccctaaagtgttggctgctgctttggaggcacataaaaag
gatagttcgtcttctggaaacatcttctcctcgattggggaagaaaacggagaggccgaa
gaggatggatggaagcaggccagtggatccggaaagaaatggtctagtgttgttaatggc
gcttctacgccaaagcccaaatcagccaatggacatggggctgagatgattggtgctgaa
ggtgcgatacccgttcgaaagtcagatatccttatgtcgctattcagcaacaggatttcg
gatgggtggtttgcctag

DBGET integrated database retrieval system