KEGG   Sclerotinia sclerotiorum: SS1G_04975Help
Entry
SS1G_04975        CDS       T01071                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SS1G_04975
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SS1G_04975
Enzymes [BR:ssl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SS1G_04975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 549 aa AA seqDB search
MAAINKMAGTSVDPEQEERIFLEEVAAVKKWWEDERWRYTKRPFTAEQIVAKRGNLKIEY
PSNALSKKLWGILEDRFKNKDASFTYGCLEPTMLTQMAKFLDTVYVSGWQSSSTASSSDE
PGPDLADYPYTTVPNKVAHLFMAQLFHDRKQREERVMTASKADRAKLQNVDYLRPIIADG
DTGHGGLTAVMKLTKLFVEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRA
QADIMGSDLISIARTDAEAATLITTTIDPRDHPYILGSTNANLKPLNDLMLAGERAGKTG
AQLQAIEDEWTAQADLKLYNDAVVAAIKSNPSNTQADDLISKFLNDVKGKSNSEARALAK
SIAGVEIHWDWDAPRTREGYYRLKGGCGCAINRAIAYAPYTDAVWMESKLPDYNQAAEFA
AGVHAVYPELKLAYNLSPSFNWKAAMPRSEQETYIQRLSKLGYCWQFITLAGLHTTALIS
HQFAEKYSTMGMRAYGELVQEPEMDFGVDVVKHQKWSGANYADELLKMVTGGVSSTSAMG
KGVTEDQFH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctgctatcaacaaaatggctggtacctcggtggatccagagcaagaagagaggatc
tttttggaagaagttgctgctgttaagaaatggtgggaagatgagagatggagatatacc
aagagaccatttactgctgagcaaattgtggcaaagaggggaaatttaaagattgaatac
ccaagcaatgcactttcaaaaaagctttggggtatcttggaggatagattcaagaataaa
gatgcttcttttacttatggttgcttggaacctaccatgttgactcaaatggcaaaattc
ctcgatacagtttatgtttctggatggcaatcatcatctactgcatcttcctccgatgaa
cctggtccagatctcgcagattacccatacactacagttcccaacaaagtagcccatctc
ttcatggcgcaactcttccacgaccgcaaacaacgagaagagcgcgtaatgaccgcctcg
aaagccgatcgtgccaagcttcaaaacgtcgattatctccgtcccattatcgcagatgga
gataccggtcatggaggtcttactgccgttatgaaattgacaaaattgtttgtggagaag
ggagctgcgggtattcatattgaggatcaagctcctggtactaagaaatgtggacatatg
gctggaaaggtccttgtacctatcagtgaacatattaatcgtttggttgccattcgtgct
caggctgatattatgggctccgatcttatctctattgctcgtacagatgccgaagctgca
accttaatcacaaccaccatcgacccgcgcgaccacccctatattctcggctcaacaaac
gctaatctcaaacccctcaacgatctaatgctggctggtgagcgagccggtaaaactggt
gctcaactccaagccatcgaagatgaatggacagcacaagccgatctcaaactttataac
gacgccgtcgtcgccgccataaaatccaatcctagcaacacccaagccgacgatctcatt
tccaaattcttaaacgatgtaaagggaaagagtaattccgaagcaagagcactcgccaaa
tcaatcgctggtgtagagattcattgggattgggatgctccacgtacaagagaaggatac
tacagattaaaaggtggatgtggctgtgccatcaaccgcgccatcgcttacgccccctac
actgacgcagtctggatggaatccaaattgccagactacaaccaagccgctgaattcgct
gcaggtgtccacgccgtctacccagaactaaaactcgcctacaacctctctccatccttc
aactggaaagccgccatgccacgctcagaacaagaaacttatattcaacgtctatctaaa
ttaggatactgttggcaatttattacattagcaggtctacacaccactgcacttatctcc
catcaatttgcggagaaatatagtacgatgggtatgagagcctatggggaattggttcag
gaacctgaaatggactttggagttgatgtggtgaagcatcagaaatggtctggagcaaat
tacgcagatgagttattgaagatggttactggaggtgtaagtagtacgagtgcgatgggt
aagggtgttacggaggatcaatttcattag

DBGET integrated database retrieval system