KEGG   Sclerotinia sclerotiorum: SS1G_05177Help
Entry
SS1G_05177        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ssl  Sclerotinia sclerotiorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 571 aa AA seqDB search
MATIPVIIKHQGKKYDVELDPTSNGETLKYQLYSLTGVEPERQKILVKGGQLKDDTDLSK
IGAKPGQTFMMMGTPAEGGTFSRPKEAIKFVEDMTEAEAAQQVGATPAGLQNLGNTCYLN
SSLQTLRVIPELQDSLQKYTPDGQSGSNLLGGFGLGSLDLTASMRDLYKQMSETQEGFPP
LMFLNALRQAFPQFNEKAKNGHGFAQQDAEEAWTQILQVLRSKLKINNKGGILGGSSSAE
VSFVDKYMAGAFKSVTECDEQAAKDGGEQPVNGEDVFLKLDCHISGATNHLRDGIVAGLE
EKIEKRSEVLGRDAIYTKKSKISRLPKYLTVHFVRFFWKREAQKKAKIMRKVTFPDELDV
VEFCTDELKQMLIPVRDKVREVRKEEEDIERARKRQKRLHDKEEADKKAGLVDEAPSSSS
NKDEKKEIKSKDGDTEMEEVVYKTDAEIDAEKAAAILEAKKELHALINPELAKDDGANKS
GLYELRGIVTHQGSSADSGHYTSYVKKQGPLDPKTGVRGEEDGKWWWFNDDKVSEVEPEK
IATLAGGGESHSALILLYKAIPLPTAEGINQ
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatacctgttattatcaagcatcaggggaagaaatatgatgttgagctcgat
cctacatctaacggcgaaacgttgaaataccagctctattccctcactggtgttgagcca
gaacgtcaaaagattttggtcaaaggtggccaacttaaagatgacaccgacctctcgaag
attggcgcgaagccaggccagacgtttatgatgatgggaacacctgcagaaggaggaaca
ttctctagaccgaaggaagcaattaaatttgttgaggacatgaccgaagcagaagctgca
caacaagtaggcgcaacgccggctggattgcagaacctgggaaatacctgttatctcaac
tcatctttgcaaactctcagagtaattccagaattgcaagattcgctgcagaagtacaca
ccggatgggcaaagtggctctaatctgctcggtggatttggacttggatctttggacttg
acagcttcgatgcgagatttatataagcagatgtcagaaacacaagaagggttcccacca
cttatgttcctcaacgctctacgacaagcgtttccacaatttaatgagaaagcgaagaat
ggacatggcttcgcgcaacaagatgccgaagaggcttggacacaaatccttcaggtacta
cgatcaaaattgaagattaacaataagggtggcattcttggaggatcttcatctgcggaa
gtctcttttgtcgataaatatatggctggagcattcaaatctgtcacagagtgtgatgag
caagcagcgaaggatggaggtgaacaaccggtgaatggagaagatgttttcttaaagctg
gattgtcacatcagtggcgcaaccaatcatctccgagatgggattgttgcaggattggag
gagaagattgaaaagagatccgaagtccttggtcgtgatgcaatttacaccaagaaatcg
aaaatttcacgcctgcctaaatatcttactgttcatttcgtccgattcttctggaaacgc
gaggctcaaaagaaagcaaagattatgcgcaaggtcacattccctgatgaactggacgtc
gttgaattctgtacagatgagctcaagcaaatgttgatcccggttagagacaaggttcgt
gaggtacgaaaggaggaggaagacattgaacgtgctcgcaagcgtcaaaagcgtctccat
gataaagaagaggctgacaaaaaagctggccttgttgacgaagcaccttcatcttcatca
aacaaagacgagaagaaggagattaaatccaaagatggcgatactgaaatggaggaggtt
gtttataagaccgatgcggagatcgatgccgaaaaggctgctgcaatcttggaagccaag
aaagagttacatgcattgatcaatcctgagcttgccaaggatgatggggctaacaagtct
ggcctttacgaacttcgtggcattgttacccatcaaggttccagtgcggatagtggccat
tacacttcatatgtgaagaagcaaggaccacttgatcccaagacaggcgtacgtggtgag
gaagatggaaaatggtggtggttcaatgatgacaaggtatccgaggttgaacctgagaag
atcgctactcttgctggtggtggggaatctcattctgcgctcatcttgctttacaaggcc
attcctttacctactgctgaaggtatcaaccagtaa

DBGET integrated database retrieval system