KEGG   Sclerotinia sclerotiorum: SS1G_05351Help
Entry
SS1G_05351        CDS       T01071                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00010  Glycolysis / Gluconeogenesis
ssl00620  Pyruvate metabolism
ssl00640  Propanoate metabolism
ssl00680  Methane metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_05351
   00620 Pyruvate metabolism
    SS1G_05351
   00640 Propanoate metabolism
    SS1G_05351
  Energy metabolism
   00680 Methane metabolism
    SS1G_05351
Enzymes [BR:ssl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SS1G_05351
Lipid biosynthesis proteins [BR:ssl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SS1G_05351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-GeneID: 5489802
NCBI-ProteinID: XP_001593923
UniProt: A7EJ58 A0A1D9QA81
Position
Unknown
AA seq 669 aa AA seqDB search
MSEGKVKPSTPVVAEAHDVDTFHPPQKMFAKHPSKPHLSGLDEYKKLYDESIKEPNKFWG
RMARELLTWQKDFETVHSGSLAGGDNAWFLEGQLNASYNCVDRHAIKNPDKPAIIYEADE
TTDGRTLTYAELLREVCRTAYVLKQMGVKKGDTVAIYLPMIPEAVIAFLACSRIGAVHSV
VFAGFSSDSLRDRVIDAQSKVVITSDEGKRGGKLIGTKKIVDDALKQCPDVTHCLVYRRT
GADVPMTKGRDWWWHEEVEKWPSYIAPEPMNSEDPLFLLYTSGSTGKPKGVMHSTAGYLL
GAAATGKYVFDIHDSDKFFCGGDVGWITGHTYVVYAPLLLGVATVVFEGTPAYPNFSRYW
DVIEKHEVTQFYVAPTALRLLKRAGDEHVKAQMKHLRVLGSVGEPIAAEVWKWYFETVGK
EEAQVVDTYWQTETGSHVIAPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVEG
VLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNV
SGHRLSTAEIEAALIEHHAVAEAAVVGINDELTGQAVNAFVALKDGNEISDALKKDLILQ
VRKSIGPFAAPKAIFVVPDLPKTRSGKIMRRILRKILAGEEDQLGDISTLSDPSVVEKII
NTVHDARKN
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggaaaagtaaaaccatctactccagtagtagcagaagctcatgatgtcgac
actttccatcctccgcaaaagatgtttgccaagcatccaagcaaacctcacttaagtgga
ctcgatgaatacaagaaactctacgatgaatcgatcaaggagcccaacaagttctgggga
agaatggcccgtgagcttttaacctggcaaaaggattttgagaccgttcacagtggatcg
ttagcaggcggcgacaatgcttggttcctagagggtcaattaaatgcttcttacaattgt
gttgatcgtcatgcaattaagaatccagacaaaccagccatcatctacgaagccgacgag
actaccgatggtcgtactcttacatacgcggaactccttcgagaagtctgcagaacagca
tatgttctcaaacaaatgggtgtcaagaagggagatactgttgcgatatacttgcccatg
attccagaagctgttattgcgttcttggcttgttcgcgtattggtgcagttcactctgtt
gtctttgctggtttctcctccgattccctcagagacagagttattgatgctcaatcgaaa
gttgttattacctcggatgagggtaagcgtggtggaaaattgatcggcacaaagaagatt
gtggatgatgcgctgaaacaatgtcctgatgtcacacactgcttggtttacagacgtacc
ggtgccgatgttccaatgaccaagggtcgtgattggtggtggcatgaggaggtcgagaaa
tggccatcttatattgctccagagccaatgaattcggaggatccattattcttactctac
acctctggatcaactggcaaaccaaagggtgttatgcactcaaccgccggttatcttcta
ggtgccgcagctaccggaaaatatgtattcgatattcacgactcggataaatttttctgt
ggtggtgatgtcggatggattacaggtcacacctatgttgtttacgctcctcttcttttg
ggtgttgcaacagtagtattcgaaggaacgccagcatacccaaatttctccagatattgg
gatgtcattgagaagcacgaggttacacaattctatgttgcgcctactgcacttagatta
ctgaagcgtgccggtgatgaacatgtcaaggcacaaatgaaacatttgagagtattggga
tcagttggtgagccaattgctgccgaggtttggaagtggtattttgagactgttggaaag
gaggaagctcaagttgttgatacttactggcaaaccgagactggttcccatgtcattgcc
cctctcgcaggtgttacccctacaaagcccggtagcgcatctcttccattttttggtatt
gagcctgcgattatcgatcctgtctccggagaagaaattcacggaaatgatgtagagggt
gtattagcattcaaacaaccatggcccagtatggctcgtactgtttggggtgcacacaag
agatatatggacacatatttgaatgtttacaagggatactacttcactggtgatggagca
ggacgtgatcacgaaggttactactggatccgaggtcgtgttgatgatgttgtcaatgtc
agcggtcatcgtctctctactgctgaaatcgaagccgctctgattgagcaccatgctgtc
gccgaagccgcagttgttggtattaacgatgagctcaccggacaagcagtcaatgctttc
gttgccctgaaggatggtaacgagatcagcgatgcattaaagaaagatcttatcttacaa
gtccgaaagagtattggtccatttgctgcaccaaaagcaatctttgttgttccagatttg
ccaaagactagaagtggtaagattatgcgtcgaattttgagaaagattctggcgggtgaa
gaggatcaattgggtgatatttccacgctctctgatccaagtgtagtcgagaagatcatt
aatacagtacacgacgcaagaaagaattaa

DBGET integrated database retrieval system