KEGG   Sclerotinia sclerotiorum: SS1G_05445Help
Entry
SS1G_05445        CDS       T01071                                 

Definition
similar to MAP kinase Mps1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SS1G_05445
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SS1G_05445
Protein kinases [BR:ssl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SS1G_05445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYTVTKELGQGAYGIVCAATNSQTQEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIVRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKRPFPTLFPNANPDALDLLDHMLAFDPS
SRIDVETALEHPYLHIWHDASDEPGCPTTFNFDFEVVEDVGEIRKLILEEVHRFRQHVRV
QPGQQGQSNGPQVPIPQDQASWRAEDPRPQEAYGQGPNDLEQDLQGGLDAMRS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcggatctccaaggaagaaaggtgtttaaggtcttcaatcaagactttatcgtcgat
gagagatatacagtaaccaaggagctcggtcaaggagcttatggtatcgtctgtgctgct
accaattcccaaacacaagaaggtgtcgcaattaagaaggtcacaaatgtctttagtaag
aagattttggcaaagcgtgcgctacgagagataaagttgttacaacatttcagaggtcat
cgtaacattacttgtctgtatgatatggacattcctcgaccagataacttcaatgagaca
tacctctatgaagagcttatggagtgtgatctcgctgctatcgtacgatccggtcaacca
ctcactgatgcacattttcaatctttcatttatcaaatcctttgtggtttaaaatatatt
cattctgcgaatgttcttcatcgtgatttgaagcccggtaatttgctggtcaatgccgat
tgcgagttgaagatttgtgattttggtcttgcaagaggtttctctgttgatcctgaagag
aatgctggatacatgacggaatatgttgctacaagatggtaccgtgcccctgagattatg
ttgagtttccagagttatacgaaagctattgatgtatggtcagtagggtgtattctcgca
gaattacttggcggtcgtcctttcttcaagggtagagattatgttgatcaactcaatcaa
attttgcatatccttggtacaccaaatgaagaaacattatcacgaattggatcgccacga
gcacaagaatacgtccgaaacttaccatacatggccaagcgacctttcccaacgttattc
cccaacgccaatcccgatgccctcgacctccttgatcatatgttagcattcgatccatcc
tcccgtattgatgttgaaaccgcccttgaacatccataccttcatatttggcacgatgct
tccgatgagcctggatgtccaacaacattcaacttcgattttgaagttgtagaagatgtt
ggtgagatcagaaagttgattttagaagaagttcaccgatttagacaacatgtccgtgtt
caacctggtcaacaaggccaaagtaatggacctcaagtacctataccacaggatcaagca
agctggagggctgaggatccgagaccacaagaagcttatgggcaaggaccaaatgatttg
gaacaagatttacaaggtggattggatgctatgcgatcatag

DBGET integrated database retrieval system