KEGG   Sclerotinia sclerotiorum: SS1G_05583Help
Entry
SS1G_05583        CDS       T01071                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SS1G_05583
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SS1G_05583
   00630 Glyoxylate and dicarboxylate metabolism
    SS1G_05583
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SS1G_05583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 542 aa AA seqDB search
MSLIDAQLQGVNISGTITDFNKKILSKDAVAFLALLHRSFDGTRKELLQRRVIRQAELDK
GSLPDFLPETKHIRENDAWRGAPPAPGLIDRRVEITGPTDRKMIVNALNSDVWTYMADLE
DSSAPTWDNMINGQVNLYDAVRKQVDFKIGEKEYKLRTDRTLPTLIVRPRGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAKELISSGLGPYFYLPKLESHLEARLWNDVFNLSQDFIAI
PRGTIRGTVLIETILAAFEMDEIIYELRDHSAGLNCGRWDYIFSVIKKFRNNPNFVLPDR
SAVTMTVPFMDAYVKLLIQTCHRRQVHAMGGMAAQIPIKNDKAANDKAMEGVYADKIREA
KAGHDGTWVAHPALAGIASEVFNKHMPTPNQMFVRRLDVKIGQNDLLNMNVPGAVTEEGI
RKNLNIGLGYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWVKHGVSTAEGKKVDKAY
ALRLLKEQADELASQGPKGNKYQLAAQYFAGQVTGEDYADFLTTLLYNEITAVGHSSPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaatcgatgctcaattacaaggcgtgaacatctctggaactattactgatttc
aataagaagattctcagtaaggatgccgttgcattcctcgctctccttcacagatctttc
gatggtaccagaaaagaacttcttcaacgtcgtgtaatcagacaagcagaacttgataag
ggttctctaccagatttccttccagaaacaaaacatatccgtgaaaatgatgcttggagg
ggagcaccacctgcaccaggattgatcgaccgtagggtggaaatcactggtccaactgac
aggaagatgattgtcaatgctttgaattcagatgtttggacatatatggcagatctcgag
gattccagtgctccaacatgggataatatgatcaatggacaagtcaatctttacgatgca
gttagaaaacaagtcgatttcaaaataggagagaaagaatacaaacttcgaaccgatcgt
acacttcccacactcatcgtaagacctagaggctggcatcttgatgagaaacatttcaca
gtggatggagaaccaatctctggcagtcttttcgatttcggcttatactttttccacaat
gctaaggaattgatcagcagtggacttggaccgtatttctacctcccaaaattggaatct
caccttgaagctcgtttatggaatgatgtattcaatctctctcaagatttcatcgccatc
ccaagaggaactattcgaggaacagttttgatcgagacgatccttgctgcatttgagatg
gatgagatcatttatgaacttcgtgatcatagcgctggtctcaactgtggaagatgggat
tatatcttcagtgtcattaagaaattccgcaacaacccaaatttcgttcttcctgatcga
tcggctgtcaccatgaccgttccattcatggatgcatatgttaagttattgatccaaaca
tgtcatcgaagacaagtacatgccatgggtggaatggccgctcaaattcctatcaagaat
gataaagccgccaatgacaaggcaatggaaggtgtatatgcggataaaatccgtgaggcc
aaagctggtcatgatggtacatgggtagctcatccagcacttgcaggtatcgcttccgaa
gtattcaacaaacacatgcccacacccaatcaaatgttcgttcgtcgcttagatgtaaag
atcggacaaaacgatcttttaaatatgaatgtccctggcgctgtcaccgaagaaggtatt
cgcaagaacttgaacataggattaggatatatggaaggatggctccgaggtgtaggatgt
atacctattaattatttgatggaagatgctgctacagcagaagttagtcgttctcaatta
tggcaatgggttaaacatggtgttagtaccgcagaaggaaagaaggtggacaaggcttat
gcgttgagattgcttaaggaacaagcagatgagttggcgagtcaagggcctaaaggaaat
aagtatcaattggcggcacagtactttgcaggtcaagttactggagaggattatgcggat
ttcttgactacgcttctttataatgaaattacggcggttggacattcatcgcctgcttct
aaattgtag

DBGET integrated database retrieval system