KEGG   Sclerotinia sclerotiorum: SS1G_05583Help
Entry
SS1G_05583        CDS       T01071                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ssl01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ssl00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ssl00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 542 aa AA seqDB search
MSLIDAQLQGVNISGTITDFNKKILSKDAVAFLALLHRSFDGTRKELLQRRVIRQAELDK
GSLPDFLPETKHIRENDAWRGAPPAPGLIDRRVEITGPTDRKMIVNALNSDVWTYMADLE
DSSAPTWDNMINGQVNLYDAVRKQVDFKIGEKEYKLRTDRTLPTLIVRPRGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAKELISSGLGPYFYLPKLESHLEARLWNDVFNLSQDFIAI
PRGTIRGTVLIETILAAFEMDEIIYELRDHSAGLNCGRWDYIFSVIKKFRNNPNFVLPDR
SAVTMTVPFMDAYVKLLIQTCHRRQVHAMGGMAAQIPIKNDKAANDKAMEGVYADKIREA
KAGHDGTWVAHPALAGIASEVFNKHMPTPNQMFVRRLDVKIGQNDLLNMNVPGAVTEEGI
RKNLNIGLGYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWVKHGVSTAEGKKVDKAY
ALRLLKEQADELASQGPKGNKYQLAAQYFAGQVTGEDYADFLTTLLYNEITAVGHSSPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaatcgatgctcaattacaaggcgtgaacatctctggaactattactgatttc
aataagaagattctcagtaaggatgccgttgcattcctcgctctccttcacagatctttc
gatggtaccagaaaagaacttcttcaacgtcgtgtaatcagacaagcagaacttgataag
ggttctctaccagatttccttccagaaacaaaacatatccgtgaaaatgatgcttggagg
ggagcaccacctgcaccaggattgatcgaccgtagggtggaaatcactggtccaactgac
aggaagatgattgtcaatgctttgaattcagatgtttggacatatatggcagatctcgag
gattccagtgctccaacatgggataatatgatcaatggacaagtcaatctttacgatgca
gttagaaaacaagtcgatttcaaaataggagagaaagaatacaaacttcgaaccgatcgt
acacttcccacactcatcgtaagacctagaggctggcatcttgatgagaaacatttcaca
gtggatggagaaccaatctctggcagtcttttcgatttcggcttatactttttccacaat
gctaaggaattgatcagcagtggacttggaccgtatttctacctcccaaaattggaatct
caccttgaagctcgtttatggaatgatgtattcaatctctctcaagatttcatcgccatc
ccaagaggaactattcgaggaacagttttgatcgagacgatccttgctgcatttgagatg
gatgagatcatttatgaacttcgtgatcatagcgctggtctcaactgtggaagatgggat
tatatcttcagtgtcattaagaaattccgcaacaacccaaatttcgttcttcctgatcga
tcggctgtcaccatgaccgttccattcatggatgcatatgttaagttattgatccaaaca
tgtcatcgaagacaagtacatgccatgggtggaatggccgctcaaattcctatcaagaat
gataaagccgccaatgacaaggcaatggaaggtgtatatgcggataaaatccgtgaggcc
aaagctggtcatgatggtacatgggtagctcatccagcacttgcaggtatcgcttccgaa
gtattcaacaaacacatgcccacacccaatcaaatgttcgttcgtcgcttagatgtaaag
atcggacaaaacgatcttttaaatatgaatgtccctggcgctgtcaccgaagaaggtatt
cgcaagaacttgaacataggattaggatatatggaaggatggctccgaggtgtaggatgt
atacctattaattatttgatggaagatgctgctacagcagaagttagtcgttctcaatta
tggcaatgggttaaacatggtgttagtaccgcagaaggaaagaaggtggacaaggcttat
gcgttgagattgcttaaggaacaagcagatgagttggcgagtcaagggcctaaaggaaat
aagtatcaattggcggcacagtactttgcaggtcaagttactggagaggattatgcggat
ttcttgactacgcttctttataatgaaattacggcggttggacattcatcgcctgcttct
aaattgtag

DBGET integrated database retrieval system