KEGG   Sclerotinia sclerotiorum: SS1G_05754Help
Entry
SS1G_05754        CDS       T01071                                 

Definition
similar to phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SS1G_05754
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    SS1G_05754
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     SS1G_05754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1122 aa AA seqDB search
MSSLHSSPNPTPPTSRVPAQQQSPHMSPYPQRTSSLNRRRGISRVRTEFLPTITSAPTVP
MSASSVTTSSSAQASPIMSPETNQVMTNNSSLQVSPEGPRGREPEHRLPPFEPLPDSIVS
RKHSQTAMAEAFTGNRSQGLMRRLSNKISRRQSTTISRDQSAGPVMLRRRSDSTNTAPDS
RHNFFNSDSDEDAHEDCIEWVDSPLGIEGLPGDYPSSNASFACSSTMTSGGGNGGLALGP
VIPTILLQGTTMIKITKKKRKFLTFVLEDEACKVSWDKTRPAKSFLIDNIKEIRLGSDAL
NYREEFKVDPQDEPRFFSILYVVPDHKSNGRSTKIMHLIAPDEQTFDLWTTTLEAISKHR
YENMSSLVAFNEKAVRNYWRGEMTKQFSEIPHAEDEEALNFEGVEQLCKNLHINTSSRFL
RERFHKADATKSKKLNFTEFQEFVKLMKRREDVSEIYKDLASDAAKGITLEEFINFIAVV
QGENVEKDRAKWESIFAKFARRSRSRDQPLQDGEAARMSEEALATFFTSIHNVPLEAMPE
TFPLDRPMHEYFISSSHNTYLMGRQVAGESSVEAYISALIKGCRCVEIDCWDGKDGRPIV
NHGHTMTRPIMFSDVMYTIAKYAFVKSHFPLWISLEVHCNDAQQAAMAQIIKDACGPLLV
TEPLDPSSQELPSPSQLLDRILIKVKKPRVDEAPAKVNGRSRGNSLSSPRVYPTQLDNSS
ISSGSLLPTPSSTSSGSNIKQSIRRTGTDETTSSSSSDSEGNEDRAKDKPKTSKIVKVLG
ELGIYSAGVKFRGFDDPESKTYNHIFSFMESTFDRNSKTQGDRRAMTRHNMRFLMRVYPN
GWRVASTNFDPLKYWRRSVQMVALNWQTHDLGMQMNDAMFAGGTDQSGYVLKPSELREIK
MLPSVPEEAGADHVKRERKNVNFSIDIISAQQLMRPKGLPSNRSVDPYVEVEVYHADDKS
KENKGVIGEGGLDASAKDGSSGLGAPHKRRTHIVQENGFNPVFNKKFNFALTTKFPELVF
VRWTVRCSPDGHSYNDKSLPLATYTAKLSSLKQGYRTLPLYDTNGDQFLFSTLFCRVKID
PATSIYVNAEANESVGVLKSLGRTVFNRTPLSPKPPVDSGHQ
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcttcattcgagtcccaatccgactcctcctacctcaagagttcccgcacaa
cagcaatcgcctcatatgtctccatatccacagagaacatcctctttgaatcgaagacgt
ggtatatcgcgtgtgcggaccgaattcctacctaccattacttccgcccctaccgttcca
atgtcggcgtcctcggtcacaacctccagctccgcacaagcgtcgcccatcatgtcaccc
gaaactaatcaagttatgaccaacaactcctcattacaagtatcccccgaaggccctcgt
gggcgtgaacctgaacatcgccttccccctttcgaacccctccccgactcaatagtttca
aggaaacatagtcaaactgccatggctgaggcattcaccggcaataggtcgcaaggtttg
atgagaaggttatcgaacaagatctcccgacgacaatcgaccactataagtcgagaccaa
agtgctggaccagtcatgttgcgacgcaggagtgacagcaccaatacagctccagattcc
agacacaacttctttaactctgattccgacgaagatgcccacgaggattgtatcgagtgg
gtggactctccattgggtattgaaggtcttcccggcgactatccaagttccaatgcctcg
ttcgcttgctcttcgacgatgactagcggcggcggtaatggaggcctcgcattgggtccc
gtcatacctaccatccttctccaagggaccaccatgatcaaaatcacaaagaagaagaga
aagtttcttacatttgttctagaagatgaagcttgtaaagtgtcatgggacaagacgaga
cctgcgaaaagcttcctcattgacaacatcaaggaaattcgactcggatctgatgctctg
aattatcgtgaagaatttaaagttgaccctcaggacgaacctcgtttcttctccatcctg
tacgtggtacccgaccacaagtcgaatggacgctcaacgaaaattatgcacttgatcgcc
cccgatgaacaaactttcgacctttggacaacaaccctggaagctatttcaaaacataga
tatgaaaacatgtcaagtcttgtggccttcaacgaaaaggcagttaggaactattggcga
ggcgagatgaccaagcagttttcggaaatacctcatgccgaagatgaagaggctcttaac
ttcgagggagtcgagcaactttgcaagaatctccatattaacacttcttccagattcctg
cgcgagcgatttcacaaggcggatgctaccaagtcgaagaaattgaactttaccgagttt
caggaatttgtgaagcttatgaaacgcagagaagatgtttcggaaatctacaaagatctt
gcttccgacgcggcgaaaggaatcacactggaagaatttatcaattttattgccgtcgta
caaggggagaatgttgaaaaagaccgagccaaatgggaatcgattttcgcgaaatttgcc
cgtcgatcaagatcacgagatcagccactgcaagatggcgaggccgcacgaatgagtgaa
gaagcccttgctaccttcttcacatctatccacaatgttcccctagaggcgatgcccgaa
acatttcccctcgatcgtcctatgcatgagtacttcatctctagctctcacaatacttac
ctcatgggtcgacaggtcgctggtgaatcgagtgttgaggcttacatatcagctctaatc
aaaggttgccggtgtgtagaaattgattgttgggatggcaaagatgggcgaccgattgtc
aatcatggacatacgatgaccaggcccatcatgttttctgacgtcatgtacaccatcgcg
aaatatgcctttgtcaaatctcacttcccgttatggatttctctggaggttcattgcaat
gatgcccagcaggcagccatggctcagatcataaaagacgcttgtggtcctttgctggtc
acagagcctcttgatccttcgtctcaagagctcccttcgccttctcaattgttggatcga
atcttgatcaaggtcaagaaacccagagtcgatgaagcaccggccaaggtcaacggtcgg
tctcgtggaaacagtcttagctcacctcgtgtttatcctactcagctcgataattcaagc
atttctagtggctccctcctacctacgccaagttcaacctccagtggaagcaatatcaag
caaagcattcgaagaactggaactgatgaaactacaagtagcagcagtagcgatagtgaa
ggaaacgaagacagagctaaggataagcccaagacaagcaagattgttaaagtcctcgga
gagcttggcatttacagtgctggtgttaaatttcgtggtttcgatgatcccgagagcaag
acctacaatcacatcttctcattcatggaatctacgtttgataggaatagcaaaactcag
ggtgatcgccgtgcaatgacaagacataacatgagatttctcatgagagtatatcccaat
ggatggcgtgtcgcatctaccaatttcgatcctctcaaatattggcgacgaagtgttcag
atggttgctctcaattggcaaactcatgatctcggtatgcaaatgaatgatgctatgttt
gcaggaggcactgatcaatctggttacgtcctcaaaccaagcgaacttcgagagattaaa
atgcttcctagtgttcccgaggaagcaggtgccgatcatgtcaagcgagagcgtaagaat
gttaacttctcgattgatatcatctctgctcaacaactcatgcgcccaaaaggtctccct
tcgaatcgttctgtcgatccatatgttgaagtcgaggtttaccatgctgatgacaagagc
aaggaaaataaaggagtcattggcgaaggtggtcttgacgcttctgctaaggatggctct
tctggtttgggtgctcctcataagcgtcgtacacacatcgtccaagagaatggcttcaat
cctgttttcaacaagaaatttaatttcgctctaacgaccaaattcccagaactcgttttc
gttcgttggactgtcagatgctccccggatggtcacagttacaatgataaaagtttaccc
ttggctacatatactgccaaactcagcagccttaaacaaggttatcgcactctacctctc
tacgatacaaacggtgatcaattcctcttttctacactcttctgtcgcgtcaaaatcgat
ccagctacaagcatctatgtcaatgccgaagcaaatgagagcgtcggcgtactaaagagt
ctcggtcgtaccgtcttcaatcgaacacctctatcaccaaaacccccggtcgatagtggt
caccaatga

DBGET integrated database retrieval system