KEGG   Sclerotinia sclerotiorum: SS1G_05754Help
Entry
SS1G_05754        CDS       T01071                                 

Definition
similar to phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ssl00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ssl04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1122 aa AA seqDB search
MSSLHSSPNPTPPTSRVPAQQQSPHMSPYPQRTSSLNRRRGISRVRTEFLPTITSAPTVP
MSASSVTTSSSAQASPIMSPETNQVMTNNSSLQVSPEGPRGREPEHRLPPFEPLPDSIVS
RKHSQTAMAEAFTGNRSQGLMRRLSNKISRRQSTTISRDQSAGPVMLRRRSDSTNTAPDS
RHNFFNSDSDEDAHEDCIEWVDSPLGIEGLPGDYPSSNASFACSSTMTSGGGNGGLALGP
VIPTILLQGTTMIKITKKKRKFLTFVLEDEACKVSWDKTRPAKSFLIDNIKEIRLGSDAL
NYREEFKVDPQDEPRFFSILYVVPDHKSNGRSTKIMHLIAPDEQTFDLWTTTLEAISKHR
YENMSSLVAFNEKAVRNYWRGEMTKQFSEIPHAEDEEALNFEGVEQLCKNLHINTSSRFL
RERFHKADATKSKKLNFTEFQEFVKLMKRREDVSEIYKDLASDAAKGITLEEFINFIAVV
QGENVEKDRAKWESIFAKFARRSRSRDQPLQDGEAARMSEEALATFFTSIHNVPLEAMPE
TFPLDRPMHEYFISSSHNTYLMGRQVAGESSVEAYISALIKGCRCVEIDCWDGKDGRPIV
NHGHTMTRPIMFSDVMYTIAKYAFVKSHFPLWISLEVHCNDAQQAAMAQIIKDACGPLLV
TEPLDPSSQELPSPSQLLDRILIKVKKPRVDEAPAKVNGRSRGNSLSSPRVYPTQLDNSS
ISSGSLLPTPSSTSSGSNIKQSIRRTGTDETTSSSSSDSEGNEDRAKDKPKTSKIVKVLG
ELGIYSAGVKFRGFDDPESKTYNHIFSFMESTFDRNSKTQGDRRAMTRHNMRFLMRVYPN
GWRVASTNFDPLKYWRRSVQMVALNWQTHDLGMQMNDAMFAGGTDQSGYVLKPSELREIK
MLPSVPEEAGADHVKRERKNVNFSIDIISAQQLMRPKGLPSNRSVDPYVEVEVYHADDKS
KENKGVIGEGGLDASAKDGSSGLGAPHKRRTHIVQENGFNPVFNKKFNFALTTKFPELVF
VRWTVRCSPDGHSYNDKSLPLATYTAKLSSLKQGYRTLPLYDTNGDQFLFSTLFCRVKID
PATSIYVNAEANESVGVLKSLGRTVFNRTPLSPKPPVDSGHQ
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcttcattcgagtcccaatccgactcctcctacctcaagagttcccgcacaa
cagcaatcgcctcatatgtctccatatccacagagaacatcctctttgaatcgaagacgt
ggtatatcgcgtgtgcggaccgaattcctacctaccattacttccgcccctaccgttcca
atgtcggcgtcctcggtcacaacctccagctccgcacaagcgtcgcccatcatgtcaccc
gaaactaatcaagttatgaccaacaactcctcattacaagtatcccccgaaggccctcgt
gggcgtgaacctgaacatcgccttccccctttcgaacccctccccgactcaatagtttca
aggaaacatagtcaaactgccatggctgaggcattcaccggcaataggtcgcaaggtttg
atgagaaggttatcgaacaagatctcccgacgacaatcgaccactataagtcgagaccaa
agtgctggaccagtcatgttgcgacgcaggagtgacagcaccaatacagctccagattcc
agacacaacttctttaactctgattccgacgaagatgcccacgaggattgtatcgagtgg
gtggactctccattgggtattgaaggtcttcccggcgactatccaagttccaatgcctcg
ttcgcttgctcttcgacgatgactagcggcggcggtaatggaggcctcgcattgggtccc
gtcatacctaccatccttctccaagggaccaccatgatcaaaatcacaaagaagaagaga
aagtttcttacatttgttctagaagatgaagcttgtaaagtgtcatgggacaagacgaga
cctgcgaaaagcttcctcattgacaacatcaaggaaattcgactcggatctgatgctctg
aattatcgtgaagaatttaaagttgaccctcaggacgaacctcgtttcttctccatcctg
tacgtggtacccgaccacaagtcgaatggacgctcaacgaaaattatgcacttgatcgcc
cccgatgaacaaactttcgacctttggacaacaaccctggaagctatttcaaaacataga
tatgaaaacatgtcaagtcttgtggccttcaacgaaaaggcagttaggaactattggcga
ggcgagatgaccaagcagttttcggaaatacctcatgccgaagatgaagaggctcttaac
ttcgagggagtcgagcaactttgcaagaatctccatattaacacttcttccagattcctg
cgcgagcgatttcacaaggcggatgctaccaagtcgaagaaattgaactttaccgagttt
caggaatttgtgaagcttatgaaacgcagagaagatgtttcggaaatctacaaagatctt
gcttccgacgcggcgaaaggaatcacactggaagaatttatcaattttattgccgtcgta
caaggggagaatgttgaaaaagaccgagccaaatgggaatcgattttcgcgaaatttgcc
cgtcgatcaagatcacgagatcagccactgcaagatggcgaggccgcacgaatgagtgaa
gaagcccttgctaccttcttcacatctatccacaatgttcccctagaggcgatgcccgaa
acatttcccctcgatcgtcctatgcatgagtacttcatctctagctctcacaatacttac
ctcatgggtcgacaggtcgctggtgaatcgagtgttgaggcttacatatcagctctaatc
aaaggttgccggtgtgtagaaattgattgttgggatggcaaagatgggcgaccgattgtc
aatcatggacatacgatgaccaggcccatcatgttttctgacgtcatgtacaccatcgcg
aaatatgcctttgtcaaatctcacttcccgttatggatttctctggaggttcattgcaat
gatgcccagcaggcagccatggctcagatcataaaagacgcttgtggtcctttgctggtc
acagagcctcttgatccttcgtctcaagagctcccttcgccttctcaattgttggatcga
atcttgatcaaggtcaagaaacccagagtcgatgaagcaccggccaaggtcaacggtcgg
tctcgtggaaacagtcttagctcacctcgtgtttatcctactcagctcgataattcaagc
atttctagtggctccctcctacctacgccaagttcaacctccagtggaagcaatatcaag
caaagcattcgaagaactggaactgatgaaactacaagtagcagcagtagcgatagtgaa
ggaaacgaagacagagctaaggataagcccaagacaagcaagattgttaaagtcctcgga
gagcttggcatttacagtgctggtgttaaatttcgtggtttcgatgatcccgagagcaag
acctacaatcacatcttctcattcatggaatctacgtttgataggaatagcaaaactcag
ggtgatcgccgtgcaatgacaagacataacatgagatttctcatgagagtatatcccaat
ggatggcgtgtcgcatctaccaatttcgatcctctcaaatattggcgacgaagtgttcag
atggttgctctcaattggcaaactcatgatctcggtatgcaaatgaatgatgctatgttt
gcaggaggcactgatcaatctggttacgtcctcaaaccaagcgaacttcgagagattaaa
atgcttcctagtgttcccgaggaagcaggtgccgatcatgtcaagcgagagcgtaagaat
gttaacttctcgattgatatcatctctgctcaacaactcatgcgcccaaaaggtctccct
tcgaatcgttctgtcgatccatatgttgaagtcgaggtttaccatgctgatgacaagagc
aaggaaaataaaggagtcattggcgaaggtggtcttgacgcttctgctaaggatggctct
tctggtttgggtgctcctcataagcgtcgtacacacatcgtccaagagaatggcttcaat
cctgttttcaacaagaaatttaatttcgctctaacgaccaaattcccagaactcgttttc
gttcgttggactgtcagatgctccccggatggtcacagttacaatgataaaagtttaccc
ttggctacatatactgccaaactcagcagccttaaacaaggttatcgcactctacctctc
tacgatacaaacggtgatcaattcctcttttctacactcttctgtcgcgtcaaaatcgat
ccagctacaagcatctatgtcaatgccgaagcaaatgagagcgtcggcgtactaaagagt
ctcggtcgtaccgtcttcaatcgaacacctctatcaccaaaacccccggtcgatagtggt
caccaatga

DBGET integrated database retrieval system