KEGG   Sclerotinia sclerotiorum: SS1G_05801Help
Entry
SS1G_05801        CDS       T01071                                 

Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SS1G_05801
Transcription machinery [BR:ssl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SS1G_05801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 407 aa AA seqDB search
MGANPQNPPKRKATEEPPSTPVDSKRMKMNEAELSAHLKKMNTEHPANINIIPFPEKPAV
IEEREGEIEFRVVNNDDTNASTVILSGLKGIFQKQLPKMPKEYIARLVYDRNHLSIALVK
VSPLEVIGGITYRPFDDREFAEIVFCAISSDQQVKGYGAHLMNHLKDYVKASSNVMYFLT
YADNYAIGYFKKQGFTKEITLEKSRWMGYIKDYEGGTIMQCEMLPRVRYLEHSRMILKQK
EVVNAKILAFSKSDEVHAPPKQWKNGVCKIDPMSIPAIRASGWTPAMDELARQPRHGPNF
SQLQRLLSSLQNYHQSWPFISPVNINDVADYYDVILNPMDFQTMETKLEQDLYEKPEDFI
ADAMLIYTNCKKYNNDSTPYAKCATKVEKYMWSLIKEIPEWSYLLDN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaaatcctcaaaatcctccaaaacgaaaggctacagaagagccacctagtact
cctgttgattctaaaaggatgaaaatgaatgaagccgaattgtctgcccatttaaagaag
atgaatacagaacatcctgccaacatcaacatcatacctttcccagaaaaaccggcggta
attgaagagcgtgagggtgaaatcgaatttcgagttgtcaacaatgacgatacgaatgca
agcactgtaatcctctcgggactgaaaggtatttttcaaaaacagttgccaaagatgcca
aaggaatacattgctcgtttagtctatgatcgaaaccatttatctattgctttggtaaaa
gtttcaccactggaagtaataggaggaattacatatcgaccatttgatgatcgcgagttt
gcggaaattgtcttttgtgccatatcatctgatcaacaggtcaaaggatatggtgcacat
ctcatgaaccatctaaaagactacgtcaaggcttcctctaacgtcatgtacttcctcacc
tacgctgataattatgccattggatactttaagaaacagggattcactaaagaaatcact
ttggagaaaagtcgctggatgggttacatcaaagattatgaaggtggaacaattatgcaa
tgcgagatgctcccaagagttcgttacctcgaacactctcgaatgatcttgaaacaaaag
gaggtagttaatgcaaagatcctcgccttcagcaaatcagacgaagttcacgcaccaccc
aaacaatggaagaatggcgtttgcaaaatagatccaatgtctatcccagctattcgtgct
tctggttggacacctgccatggatgaattagctcgtcaacctcgtcatggaccaaacttc
tcacagctacaaagactcctgagttctcttcagaattatcatcaatcttggccattcatc
tcacctgtcaacattaatgatgtagccgattactacgatgtaattttgaatccgatggac
tttcaaaccatggaaacgaagcttgaacaggatttgtatgaaaagccggaagattttatc
gcagacgcaatgttgatttacaccaattgtaagaaatacaacaatgattcgactccgtat
gcaaagtgtgctaccaaagtggagaaatatatgtggagtcttatcaaagaaattcctgag
tggtcatacttattggacaattag

DBGET integrated database retrieval system