KEGG   Sclerotinia sclerotiorum: SS1G_05823Help
Entry
SS1G_05823        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SS1G_05823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 626 aa AA seqDB search
MSNSFAPLDPVSNGPSTKKRVAYFYDSDVGNYAYVAGHPMKPHRIRLAHSLIMNYGVYQK
MEIYRAKPATRHEMTQFHTDEYIDFLQRVTPDNMDSFAKEQGKYNVGDDCPVFDGLFEFC
GISAGGSMEGAARLNRSKCDIAINWAGGLHHAKKSEASGFCYVNDIVLGIIELLRFKKRV
LYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGQGKNYAVNFPLRD
GIDDVTYKSIFEPVIQSVMDYYQPEAIVLQCGGDSLSGDRLGCFNLSMRGHANCVQFVKS
FNKPTLVLGGGGYTMRNVARTWAFETGVLVGKEMDPVLPYNEYYEYYGPDYELDVRASNM
ENANSKDYLEKIKIQVIENLKRTAHAPSVQMQDVPRTTLAGTTDEDDDILADADEDENMD
VRHTQHRNDKHIARDDEFDEADEEEANLANGAFAQNGQAKQRNHTYSDVDMDSGVPTPEI
EIHDEIEDAPIAVTEANAQVNAELMEQKTQDATPTDTLEVGPSNAPSLSNSPKPVVDNEG
DIDMTEPLDAQAVPEKSEKSPASPAASVKANIATNIEAVASNAETVPETVAPKTEPVILK
QESDTERQDTDMTAEASEKVTEQAQS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattccttcgcgcctttagatccagtgtcgaatgggccaagcaccaaaaagagg
gtggcatacttctacgactcagatgtcggaaattatgcctacgttgcaggtcatcccatg
aaacctcatagaatacgattggcacatagtttgattatgaattatggagtttaccagaaa
atggagatttaccgagccaaaccagcaacccggcacgaaatgacacaattccataccgat
gaatacattgactttcttcagagagttactcccgacaacatggattcctttgcaaaggaa
cagggaaagtataacgttggagatgattgtcctgtcttcgatggactgttcgaattctgc
ggaattagcgctgggggtagtatggagggtgcagcccgactgaatcgttcaaaatgcgac
atcgcaatcaattgggctggaggattacatcatgcaaagaaaagtgaagcaagtggcttc
tgttatgtcaatgatattgtcctcggcataatcgagttgttgcgcttcaagaagcgagtt
ctctacattgatatcgatgttcatcacggtgatggtgtcgaggaagccttttataccacg
gatagagtgatgacagtttcgttccacaaatatggcgaatatttcccaggaactggtgaa
ctacgagatatcggtgttggacaaggcaaaaattacgcagttaatttcccacttcgcgac
ggtatcgatgatgttacttataaatccatctttgaacctgtcattcaaagtgtaatggat
tactatcagccagaagccatagttcttcaatgtggtggagacagtctttctggagaccgc
ttggggtgttttaatttgagcatgaggggccatgccaattgtgttcaatttgtcaaaagc
tttaacaagcccactttagtgcttggaggaggcggttacactatgcgtaatgttgcgcga
acttgggcatttgagactggtgttctagttggcaaggagatggatcccgtactcccttac
aacgaatattacgagtattacggccctgattatgagcttgatgttcgagcctctaatatg
gagaatgctaattcgaaagattatctcgagaagataaaaattcaagtcatcgagaatttg
aagagaactgctcacgccccatctgtgcaaatgcaagatgtaccccgtactactttagct
ggaacgaccgacgaagatgatgatattttagctgatgctgatgaagacgaaaacatggat
gttcgtcatactcagcatcgcaacgataaacatatagctcgggacgatgagttcgatgaa
gctgatgaagaggaagcgaaccttgcaaatggagcatttgctcaaaatggccaagcaaaa
caacgcaatcacacttactcggatgttgatatggatagtggtgttcctactccagagatc
gaaatccatgacgagattgaagatgctccaatagctgtcaccgaggccaatgcacaagta
aatgcggagcttatggaacaaaagactcaagacgcaacccccaccgatactcttgaagtg
ggcccatcaaatgccccatctctctcaaactcgcctaaaccggttgtggacaatgaaggc
gatattgatatgacggagccgctcgacgcccaggcagtcccagagaaatctgaaaaatca
cctgcatcgccggcagcctcggtcaaagccaatattgctacgaacattgaggcggtcgct
agcaatgctgaaactgtgcctgagacagtcgccccaaaaacagagcctgtaatattgaag
caggaaagcgacactgaaagacaagataccgatatgacagcagaagcaagtgagaaggtc
accgagcaagctcaatcatga

DBGET integrated database retrieval system