KEGG   Sclerotinia sclerotiorum: SS1G_05932Help
Entry
SS1G_05932        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SS1G_05932
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SS1G_05932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 LEA_1
Motif
Other DBs
NCBI-GeneID: 5488857
NCBI-ProteinID: XP_001593010
UniProt: A7EKT5 A0A1D9Q5J1
AA seq 345 aa AA seqDB search
MFARQTLRAAQPFRSQYRRYATESSSSGSNTALYTGVAAAVAGAGYYFMSQGDNAAKVKD
AAKDAEAKAKEALGQGQAKVEGAVGKAAFTGGDQGFISLKLDSVELVNHNTKKFRFELPE
SDQVSGLHVTSALITKYKGPEMQKPAIRPYTPTSDEGEKGFIDLLVKKYPNGVMSEHMHE
MVPGQRLDFKGPIPKYAWSANKHDHIALIAGGTGITPMYQLARAIFNNPADKTKVTLVFA
NVTEEDILLKREFEDLENTYPQRFRAFYVLDNPPKSWKGGKGFINKELLKTVLPEPKSEN
IKLFVCGPPGMYKAISGGKVSPSDQGELAGILKELGYSKDQVYKF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaagacagaccctcagagcggctcagcctttcagaagtcaataccgacgatat
gccaccgaatcctcaagcagcggctcgaatactgccttgtacaccggcgtcgcagcagca
gtagctggtgcaggttactatttcatgagtcagggagataatgccgcaaaggtcaaggat
gcagcaaaagacgcagaagccaaggcaaaggaggctcttggacagggacaagctaaggtt
gaaggagctgttgggaaagctgctttcactggtggtgatcaaggcttcatcagtcttaaa
ttggacagcgtggagcttgtcaatcacaacaccaaaaaattcagattcgagcttcctgag
agcgaccaagtcagcggattacatgttacttctgctcttattacaaagtataagggtccg
gagatgcaaaagcctgcaattcgtccttatacccccacaagtgacgagggtgaaaagggt
tttattgaccttcttgtaaagaaatacccaaatggtgttatgtccgaacacatgcacgaa
atggttccaggtcaaagattagacttcaaggggcctatccccaaatacgcatggtcagca
aacaagcatgaccatattgctctcattgctggaggaaccggtattactccaatgtaccaa
ctcgcacgagctatcttcaacaacccagcagacaagacaaaggttacattggtattcgca
aacgtcaccgaagaagatatcttattgaagcgcgaattcgaagatctcgagaacacatac
ccacaaagattccgcgctttctacgtcttagataacccacccaaatcatggaagggtgga
aaaggattcatcaacaaggagcttttgaagactgttctccccgaacccaagtccgagaac
attaaactcttcgtttgtggtcctccaggaatgtacaaggctatctctggtggaaaggtt
tctccttccgatcagggtgaattggctggtatcttgaaggagttgggatactcaaaagat
caagtttataagttttag

DBGET integrated database retrieval system