KEGG   Sclerotinia sclerotiorum: SS1G_06348Help
Entry
SS1G_06348        CDS       T01071                                 

Definition
similar to acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SS1G_06348
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SS1G_06348
   00640 Propanoate metabolism
    SS1G_06348
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SS1G_06348
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SS1G_06348
Enzymes [BR:ssl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SS1G_06348
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SS1G_06348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2285 aa AA seqDB search
MADQHTNGTVPIISSTNGGGSSYAARHNLADHFIGGNKLENAPASKVKDFVAASDGHTVI
TNVLIANNGIAAVKEIRSVRKWAYETFGDEKAIQFTVMATPEDLQANADYIRMADQYVEV
PGGTNNNNYANVELIVDVAERMNVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSA
MRSLGDKISSTIVAQHAKVPCIPWSGTGVDKVEVNEDGIVTVEDEVYKKGCIQSWEEGLE
KAKEIGFPVMIKASEGGGGKGIRKAESEQGFEALYKAAASEIPGSPIFIMKLAGNARHLE
VQLLADEYGNNISLFGRDCSVQRRHQKIIEEAPVTVAKQATFQAMEKAAVRLGRLVGYVS
AGTVEYLYSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGLPLHRIRDIRL
LYGVDPSTTTEIDFDFSQEKSIQTQRRPTPKGHTTACRITSEDPGEGFKPSSGTMHELNF
RSSSNVWGYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSIRGDFRTTV
EYLIKLLETPAFEDNTITTGWLDELISNKLTAERPDPMLAVVCGAVTKAHIASEACISEY
RTSLEKGQVPSKDILKTVFPIDFIYDGHRYKFTATRSSLDSYHLFINGSKCSVGVRALSD
GGLLVLLSGRSHNVYWKEEVGATRLSVDSKTCLLEQENDPTQLRTPSPGKLVKFTVENGE
HIKAGQAFAEVEVMKMYMPLIAAEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAQP
FLGHLPDLGPPQIVGTKAAQRFVLLRNILNNILDGFDNQVIMGSTLKELIEVLRDPELPY
GEFNAQFSALHARMPQKLDATLTQILDRSKARNAEFPAKNLSKALQKFLDENVAPADVDL
LTASLAPLIEILNRYQNGPKAHEFAVFSGLLQKYASVERLFSGRTSRDEEVILKLRDENK
DDIAKVVQTVLSHSRVGAKNNLILAILEEYRPNKPNAGDVAKYLRAPLKSLTELESRQTA
KVSLKAREILIQCALPSLEERAAQMEHILRSSVVESRYGETGWEHREPDLEVLKEVVDSK
YTVFDVLPIFFGHSDPWVSLAALEVYIRRAYRAYSLQKIEYHNESADPPFIVSWDFVLRK
VGASEFGMPIQSSAPSTPATPSYESGNPFKRISSISDMTYLTNKPDHEPTRKGVIVPVQY
LDEAEEYLQRALEVFPVAGGKKKGNGLLPELGGKRKVAPPRLDTEDELTAVCNVAIQDAE
SLDDNETVAKIKLIVNDYKEELLNRRIRRLTFICGHKDGSYPGYYTFRGPNYEEDESIRH
SEPALAFQLELGRLSKFKITPVFTENRNIHIYEAVGKEATSDKRYFTRAVVRPGRLRDEI
PTAEYLISESDRLMNDILDALEIIGNNNSDLNHIFINFSPVFPLQPPEIEQALGGFLERF
GRRLWRLRVTGAEIRIICTDPSTGMPYPVRVVITNTSGYVIQVEMYAERKSEKGGEWVFQ
SIGGTTKIGSMHLRPVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAIQNSWVKAV
RKHSSLADKQPPTGECIEYSELVLDDNDGLAEVLREPGTNTHGMVGWLVTAKTPEYPRGR
KFVIVANDITFRIGSFGPKEDQFFHKCTELARKMGIPRIYLSANSGARIGMAEELMPHFK
VAWKNPERQEAGFKYLYLDTDTKKRFEDGKSKDVITEEVVEDGETRHKIVTIVGAEDGLG
VECLKGSGLIAGATSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPA
INKLLGREVYTSNLQLGGTQIMYKNGVSHMTANDDFEGVSKIVEWMAYVPDKRNSPLPIG
PAADSWDRDIVYTPPEKQPYDVRNIIAGKEDDEGFMSGLFDKDSFVESLGGWAKTVVVGR
ARLGGIPMGVIAVETRSVENITPADPANPDSTEQISNEAGGVWYPNSAFKTAQAIKDFNN
GEQLPLMILANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWV
VVDPTINPEYMEMYADEDARGGVLEPEGIVNIKYRKDKQLETMARLDPEYAELKKQLLDN
SLGQEKLSEVKLRVEQREKALLPVYNQISLQFADLHDRAGRMKAKGVIRESLKWREARRF
FYWRVRRRVNEEYILKRMLSANSKSPNGTRPENLRKLAAWTAIPAFETDDKSVAMWYEEN
RKVVHEKVEHLKIEGVAAEVATLLRASGPGAKGGLSGGAMAGIRQVLSMLPVEEREEALK
FLGRS
NT seq 6858 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaacacacaaatggcacagtgccaataatttcctcaacaaatggaggtggt
agctcatatgctgctcgacataatcttgcggatcacttcatcggcggtaataagttggaa
aatgctcccgcgagtaaggttaaggattttgtagccgcttcggatggtcatactgttatt
acgaatgttctgatagcaaataatggaattgcagcagttaaagagattcgatcggtgcgg
aaatgggcctacgaaaccttcggagatgaaaaggctattcaattcacggtgatggccacc
ccggaagatcttcaagccaatgcggattatattcgtatggcagatcaatatgttgaagtt
ccgggtggtacaaataacaacaattacgcaaatgtggaattgattgttgatgtggccgag
agaatgaatgttcatgctgtatgggctggatggggtcatgcatcagaaaatccaaaactt
ccggaatccttagctgcgagtccgaaaaagattgtgttcattggtcctccaggttcggcc
atgcgatcgctcggtgacaagatctcctccacgatcgtcgcacaacacgctaaagtacct
tgtataccttggtcaggaactggtgttgacaaggtcgaggtcaatgaggacggtatcgtc
accgttgaggatgaggtgtacaagaagggatgtatccaatcgtgggaagaaggtctggaa
aaggccaaagagatcggatttccggttatgattaaggcatctgaaggtggtggtggaaag
ggtattcgaaaagctgaatccgagcaaggtttcgaggccctttacaaagctgccgcgagc
gagattcccggttcccctatctttattatgaagttggccggaaatgcaagacatttggag
gttcaattattggctgatgagtacggaaacaatatttcgctctttggtagagattgttcc
gtgcaaagaagacatcaaaagattattgaagaggccccagttactgtcgctaaacaagcc
actttccaggctatggagaaggccgctgttcggcttggtcgtcttgtaggatacgtttcc
gccggtaccgttgaatatctgtattcgcactccgatgacaaattttacttcttggaattg
aacccaagattgcaagtcgaacatcctacgactgagatggtcagtggtgttaatttgcct
gctgctcaacttcaaattgccatgggtcttcctttgcacagaataagagatattagatta
ttgtatggagttgatccttcaactactaccgaaatcgattttgatttctctcaagagaag
agcattcaaacacaaagaagaccaacgccaaagggacataccacggcttgtcgtatcaca
tccgaagatccgggagagggtttcaaaccttcaagtggtacaatgcacgaattgaacttc
agaagtagttctaacgtttggggttatttctctgttggtacagctggtggtatccacagt
ttctctgattctcaattcggtcatattttcgcctatggtgagaatcgatcggcatcacga
aaacatatggttgttgctttgaaggaattgagtattcgtggtgatttcagaactaccgtc
gaatacttgattaagctcttggaaactcctgctttcgaagataacaccattaccactgga
tggcttgatgaacttatctctaataaattgactgctgagcgaccagatcctatgcttgcg
gttgtttgtggtgctgtgaccaaggcccacattgctagcgaggcttgtatttctgaatac
agaacttctttggagaagggtcaagttccctcaaaagatatcctcaagaccgtcttcccc
atcgactttatttatgacggtcaccgatacaagttcactgctactcggtccagcttggac
agctaccatcttttcatcaacggatctaaatgctcggttggtgttcgtgctttgagtgac
ggtggtcttcttgtccttctcagtggacgatctcacaatgtttactggaaggaagaagtt
ggtgctactcgtttgagtgtcgacagcaaaacttgcttacttgagcaagagaacgaccca
acgcaactcagaactccatctccaggaaagcttgtcaagttcactgttgagaacggagag
cacatcaaggccgggcaggcatttgccgaagtcgaagtcatgaagatgtacatgcctctg
attgccgctgaagatggtatcgtacaactcatcaagcaaccaggagcaactcttgaagct
ggtgatattcttggtatacttgctttagacgatccatctagagtcaagcatgcccaacct
ttcttgggacatcttccagatcttggaccaccacaaattgtaggtaccaaggctgctcag
cgctttgtcctcctccgtaacattcttaataatatccttgatggtttcgataatcaagtc
atcatgggttctacattgaaggagttgattgaggttctccgagatccagagttgccatat
ggtgaattcaatgctcagttctcagctcttcatgcgagaatgccccaaaaattggacgct
actttgactcaaatccttgaccgtagcaaggcccgcaatgctgaattcccagctaagaat
ctttcaaaggctttgcaaaaattcttggacgagaatgttgcacctgccgatgtcgatctc
ctcaccgcttctcttgccccattgattgagattctcaaccgatatcaaaatggaccaaaa
gcgcacgaatttgccgtcttctccggtcttctgcagaagtatgcatccgtcgagcgtctc
ttttcaggccgcacttcccgagatgaggaagttattcttaagctcagagatgaaaataag
gatgacatcgccaaggttgttcaaactgtcttgtcgcacagcagagttggtgcaaagaac
aatttgattctcgcaattctcgaggagtatcgaccaaacaagccaaatgccggtgatgtt
gccaagtatctcagagctccactcaaaagtcttaccgagcttgagtctcgccaaactgcc
aaggtttctttgaaggctcgtgagattcttattcaatgtgctctaccttctttggaggag
cgtgctgcacaaatggagcacatccttcgatcttccgtcgtggaatcgagatatggtgag
accggatgggagcacagagagcctgatcttgaggttcttaaggaggtcgttgactcgaag
tacactgtctttgatgtcttgccaattttcttcggccatagtgatccctgggtgtctctt
gcagctcttgaggtttacattcgtcgtgcctacagagcgtactctttacagaagattgag
taccacaatgagagtgccgatcctcctttcattgtgtcatgggacttcgtcctgagaaag
gttggagcttcagaatttggaatgccaattcaatcctctgctccttcgacaccagccacc
ccttcatatgaatctggcaacccattcaaacgtatcagctctatcagtgatatgacttac
cttaccaacaagcccgatcatgaaccaacaagaaagggtgtaattgttccagtccaatat
ctcgacgaggctgaagaatacttgcaacgagcccttgaggtcttcccagttgctggtggt
aagaagaagggtaatggtctcttgccagaactcggtggcaagcgcaaggttgcacctcca
cgtcttgataccgaagatgagcttactgctgtgtgcaatgtcgctattcaagatgccgaa
agtcttgatgacaatgagactgtcgctaagatcaaactgattgtcaacgactacaaagag
gaacttctcaaccgtcgcattcgtcgtcttacatttatctgcggtcacaaagatggttcg
taccctggatactacacattcagaggccccaactatgaggaagatgagagtattcgtcac
agcgagcccgctttggctttccaacttgaacttggaaggctctctaagttcaagatcact
cctgttttcaccgaaaacagaaacatccacatttatgaggctgttggaaaggaagctaca
agtgacaagagatatttcactcgtgctgtcgttcgtcctggaagacttcgtgatgagatt
cctactgctgaatacttgatctctgagtccgatcgattgatgaatgatattttggacgct
cttgagattatcggaaacaacaactctgaccttaatcacattttcatcaatttctcacca
gttttccctcttcaacctcccgagatcgaacaagctcttggtggtttcttggagcgtttc
ggtagacgtctttggagactccgcgttactggtgctgaaatccggattatttgtacggac
ccttccactggtatgccatatcctgttcgtgttgtcatcaccaacacttctggttatgtc
attcaagttgaaatgtacgctgagcgtaaatctgagaagggtggtgaatgggtcttccaa
agtattggcggtactacaaagattggttccatgcacttgagaccagtatctactccttat
cctaccaaggaatggttgcagccaaagagatacaaggctcatctcatgggtactcaatac
gtctacgatttcccagagctattcagacaagccattcagaacagctgggttaaggctgtt
cgcaagcactcttctttggctgataaacaaccacctactggcgaatgtattgagtacagt
gagcttgtattggatgacaatgatggtcttgctgaggtcttgcgcgaacctggtaccaat
actcatggtatggttggttggctcgtaaccgccaagacaccagagtatcctcgaggcaga
aaattcgtcatcgttgccaatgatatcaccttcagaattggtagtttcggaccaaaggaa
gatcaattcttccacaagtgcacagaacttgcaagaaagatgggcattccacgtatttac
ctttctgcaaactctggtgctcgtattggtatggctgaagaactcatgcctcatttcaag
gttgcttggaaaaaccccgagagacaagaagctggtttcaaatacctttacttggacacc
gataccaagaagagatttgaggacggcaagtctaaggatgttatcaccgaggaggttgtt
gaggatggcgagacgagacataagattgttaccattgttggtgcggaggatggccttggt
gttgagtgtttgaagggttctggtttgattgctggagctacttcaagagcttatgaggac
attttcaccatcactttggtaacttgtcgttcggtcggtattggtgcatacttggttcgt
cttggtcaacgtgctattcaaatcgaaggacaacccatcattctcaccggtgcccctgcc
atcaacaaactcctcggtcgcgaggtttatacctccaacttgcaacttggcggtactcaa
attatgtacaagaatggtgtctctcacatgactgccaatgatgatttcgagggtgtttcc
aagattgttgagtggatggcctatgtacctgacaagagaaatagtcctttgccaattgga
cctgctgctgactcttgggatcgcgatattgtctacactccacctgagaaacaaccttac
gatgttagaaacatcattgctggtaaggaagatgacgaaggattcatgtccggtctcttc
gataaggactctttcgtcgaatcccttggcggttgggcaaagactgttgtcgttggtcgt
gctcgtcttggtggtatccccatgggtgtcattgctgttgaaactcgctccgttgaaaac
atcacaccagccgatcccgcaaatcctgattcaaccgaacaaatcagtaatgaggctggt
ggagtatggtatcctaactctgctttcaagaccgctcaagctatcaaggatttcaacaat
ggtgaacaattaccattgatgatcttggctaactggagaggtttctctggtggtcagcgt
gatatgtataacgaagtgctcaagtatggaagttatattgtcgatgcgttggtcaaatat
gagcagccaatcttcgtttacatcccaccattcggtgagcttagaggtggttcttgggtc
gttgttgatcctaccatcaacccagagtacatggagatgtatgctgatgaagatgctcgt
ggtggtgttttggaaccagaaggtattgtcaacatcaaataccgcaaagataagcaattg
gagaccatggcccgtctcgatccagaatacgccgaactcaagaaacaattactagacaat
tctcttggtcaagaaaagctgtctgaggtcaagcttagggttgagcagagagagaaggca
ttacttcctgtctacaatcaaatttcacttcaattcgctgatctccatgatcgtgctgga
cgtatgaaggcaaagggtgtcattagagagtcattgaagtggagagaggccagaagattc
ttttactggcgtgtacgaagacgtgtcaatgaggagtatatcctcaagcgcatgttatcc
gcgaactcgaaatcaccaaatggtaccagaccagagaacttgagaaagcttgctgcctgg
actgctatcccagctttcgaaactgatgacaagagtgtagctatgtggtacgaggagaac
agaaaggtggtccatgagaaggttgaacacctgaagattgagggtgtagctgctgaggtg
gcaacattgcttagagctagcggaccgggtgctaagggaggattgagtggtggtgctatg
gctggtatcagacaggttttatctatgttgcctgttgaagaaagagaggaggcattgaag
tttttggggaggtcatag

DBGET integrated database retrieval system