KEGG   Sclerotinia sclerotiorum: SS1G_06458Help
Entry
SS1G_06458        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SS1G_06458
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     SS1G_06458
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     SS1G_06458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 507 aa AA seqDB search
MATQSYPEGRVLIIMTGGTICMKSSPEGLIPARGFLKEGMATRPSFNDGSNPVTIGTPHR
SFQLSNPMPVMTTNTTQEYLPSLRTPPSTYSRHVRYTLYEFPVLLDSSSISSNGWTQIAT
TIERNYHLFDGFVVLHGTDSLAYTSSALSFMLSHLGKPVILTGSQASIFALQSDAVDNLL
GSLIIAGTFMIPEVCLFFHHNLFRGNRTTKVSATSFDAFASPNCEPLAKVTALGATVNWN
LVRRPRSIAKFGVQLNLDTSHVACLRIFPGIKPEMIDAVLRIPNLRGLILETFGAGNAPS
GDDGSMIKIMKEACERGVIIVNVSQCHSGSVSPLYAPATILGRAGVVFGHDLTTEAALTK
LSFLLALPDLSYNDITMQMQCSIRGEMTEEAGTAFSHPPTDQVSITAQQHAFTGLGYAIE
KGDTKSIVNILDHDRAGLLQATDYVGNTALHLGAVGPSVDVLRELLKRGASVHARNKAGN
TPLFLARKAGADELVKVLEEAGGHFGP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacaatcatacccggaaggccgtgtccttatcattatgacaggaggtaccatc
tgtatgaaatcttctccggaaggtttgattccagcaagaggctttctcaaggaaggcatg
gctacaagaccatcattcaacgatggatcaaatccagtgactatcggtacacctcacagg
tcctttcaactatcaaatcctatgccagttatgaccacaaacacaacacaagaataccta
cccagtttacgtactcccccaagcacgtattctcgacacgttcgttacactttatacgaa
tttcctgtcttactagattcatcctcaatatcttcaaatggctggacacaaatagctacc
acgattgagagaaattatcatttattcgatggtttcgtggttcttcatggtacagatagt
ctggcatacacgagttcagctttatctttcatgctgtcccatcttggaaaaccggttatc
ctcactgggtctcaagcttcaatatttgctcttcaatctgatgccgtggataaccttctc
ggatcattaatcatcgccggaacttttatgatccctgaagtatgtctcttcttccatcat
aatttatttcgtggaaatcgcacaactaaagtttcggcaacctccttcgacgcctttgct
tcaccaaattgtgaacctttagccaaagtaacggctttaggggcaacagttaattggaat
ctcgttcgtcgcccacgatcgatcgcaaagttcggagtacaattaaatcttgatacttct
cacgtagcatgccttcgtatcttccctggtatcaaaccagaaatgatcgatgctgtcctc
cgaattccaaatcttcgaggtctcatcctcgaaactttcggagctggtaacgcaccaagt
ggagatgatggaagcatgatcaagatcatgaaagaagcttgtgaaagaggtgtcatcata
gtcaacgtatcacaatgtcattctggctcagtatctcctctttacgcaccagctaccatt
cttggtcgggcaggtgtagtttttggtcacgatcttacaaccgaagcagcactcactaaa
ctttctttcctcttggctcttccagatctatcatacaacgatattacaatgcaaatgcaa
tgttccattcgaggagaaatgactgaggaagctggtacggcattttctcatccgccaact
gatcaagtttctatcacggctcaacaacacgcttttacgggattaggctacgcaattgaa
aagggtgacacaaaatctattgtcaatattcttgatcatgatcgtgcaggtcttcttcaa
gcaacggattatgttggaaataccgcattacatttgggagcagtgggtccttcagtggat
gttttaagagaattgttaaaaagaggtgcaagtgttcacgcacgtaataaagcaggaaat
acaccgttatttttggcgaggaaagctggtgctgatgaacttgttaaggttttggaggag
gcggggggacatttcggtccgtag

DBGET integrated database retrieval system