KEGG   Sclerotinia sclerotiorum: SS1G_07089Help
Entry
SS1G_07089        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ssl00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 971 aa AA seqDB search
MADDTREIRPEIVDAALSEMKLEEGIEVQDFANGTNGDISTPTEIKRSPSNTPGLVNSRS
RTPSRRQSSSQTPKSGDEEDEEVIGGDITLTVEPGKAPKLSRKSSQKVIPRPPPLFNDLP
DSTEEAASVFQVIKDCIYGAKHMGASDHDALDCDCPEEYSDGNNHACGEDSDCINRLTKM
ECGGGHKDCNCGVACQNQRFQRRQYAKVSVIKTDKKGYGLRANTDLHPDDFIFEYIGEVI
NEPTFRRRTIQYDQEGIKHFYFMSLTKHEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGE
KLRMGIFAERAIKAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGKTQTERATKLSHA
TIEALGIDDGDGWDSAVAKKPRKKKTGEDDEEYVNNVQPRGLDENGVRKVMATLMQCKEK
WIAVKLLGRIQQCEDDKVRNRVIQMHGYQILRTTLTTWKEDNNVILQVLDILYKFPRLTR
NKIVDSKIETVLEGFTNSEHEDIAFESKRLLEAWSKLEFAYRIPRRAPTLVAQVFERRPE
QVEKVTQSPSPAIIAPTGPRSVIPQRNANFILNRPMPRRNNFNMVLPPGWFTAMDQNGNA
YYYSKTGQTTWERPFMPAGAVPPPPPPKAAPKSVQTQKALQDIIDSITKEPSTTPALSSH
SAEGTPKEKKRPLDKWRSLPLEKQMKLYENTLFPHIKHVMQKYSGKLPKDDLKKFAKECG
KKLVASDFKNNRVEDPTKISEKHEKKVKKYVRDYFEKAVQKKKEMEEKRAERRKREAQPR
NNGSGTNGKEPGRENATTSSSPDVVDVDVEVDVPSPTASPSGQLEMEFLKRKREDNDESP
SENKRVKDHGTESETPTDSFTPPPPPPPPPEEGMPILGSEDPEMANGNGQIVSEEEVKEE
TEEERELRMQEEDLMRENEEAMKMEMEVESVGRLKDGDDSNQHINGENMDRHDETMKSID
GSGHEAISTIN
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgacactagggagattcggccagagattgtagacgctgcgctgagcgaaatg
aaacttgaggaagggatcgaggttcaggattttgccaatggcacaaacggagacatttct
actcctacagaaatcaagaggtctccctccaataccccaggtcttgtaaactctcgctct
cgaaccccttcaagaagacaaagcagcagccaaacgccaaaatctggagatgaagaggat
gaagaggttattggcggtgacattaccctcaccgtcgaacctggaaaagctccgaagcta
tccaggaaatcatcacaaaaagtaattcctcgaccaccccctctcttcaacgatcttcca
gattctacagaagaggcagcttcagtttttcaggtaattaaagattgcatttatggagct
aagcatatgggggcttccgatcacgatgcattggattgtgattgtcccgaggaatacagc
gatggaaataatcatgcctgcggagaggattcagattgcattaatcgattgaccaagatg
gaatgtggtggaggccacaaagattgcaattgtggtgttgcttgtcagaaccaacgcttc
caacgcagacaatatgccaaagtttcagtgatcaagacggataaaaaaggttacgggcta
cgcgcaaataccgatctacatcctgatgatttcattttcgagtatattggagaagttatc
aatgaaccgacatttcgacgacgcaccattcaatatgaccaagaaggaatcaaacatttc
tatttcatgtcccttaccaagcatgaattcgtggatgcaacaaagaaagggaatcttggc
cgattttgcaatcactcatgtaatccgaattgctatgtggataagtgggtggtcggggaa
aagttgcgcatgggcatttttgccgagcgtgcaatcaaagccggcgaggaactggtcttc
aattacaatgttgaccgatatggtgccgaccctcaaccttgttactgtggcgaaccgaac
tgtactggattcatcggaggcaagactcaaactgaacgcgctactaaactttctcatgct
accattgaagctcttggtattgatgatggtgatggttgggattcagctgttgctaagaaa
cctcggaaaaagaagacaggtgaggatgacgaagaatacgttaacaatgttcaaccaagg
ggacttgatgaaaatggagtgcgaaaggttatggcaacccttatgcaatgcaaagagaaa
tggattgccgtcaagctactgggccgaattcaacagtgcgaagacgacaaagttcgaaac
agagttatacaaatgcatggttatcaaatacttcgtacgaccttgactacttggaaggaa
gataacaacgtgatcctccaagtacttgatattctctacaagtttccacgactcactcga
aacaaaatcgttgattcgaagatcgaaacagttctagaaggcttcacaaattccgagcat
gaagacattgctttcgagtcaaagagactattggaagcatggagcaaattggagtttgca
tatagaattccaaggagagctccaactcttgttgcacaagtatttgagcgacgaccagaa
caagtagagaaagtcactcagtctccatctccagccatcattgcccctactgggccccgg
agcgttattcctcaacgcaatgccaacttcattctgaatcgacctatgcctcggcgcaac
aatttcaacatggtattgccacccggctggtttaccgcgatggaccaaaatggaaacgcc
tactattatagtaaaacgggacaaacaacatgggagaggccatttatgcccgcaggagca
gtcccgccaccaccaccgccaaaggcagctccaaagagtgtgcaaacgcaaaaggctctt
caagatattattgatagtattacaaaggagccttcgacaactcctgctctttcctcccat
tctgctgaaggcacacctaaggaaaagaaaaggccacttgataaatggcgctcactacct
ctcgagaagcagatgaaactttatgagaataccctattccctcatatcaaacacgtaatg
caaaaatactccggcaaactccccaaggatgacctcaaaaaatttgcaaaggaatgtggt
aaaaagctcgtggcctctgatttcaagaacaatcgcgttgaagatcctacaaagatatcc
gaaaagcatgaaaagaaggttaagaaatatgtgcgtgattacttcgagaaggcagtacaa
aagaaaaaggaaatggaggaaaagcgagcggaaaggagaaaacgagaagcgcagcctagg
aataatggaagtggaaccaatggaaaagaaccagggcgagaaaatgcgactacaagtagt
agtccggatgtggttgatgtggatgtggaggtcgacgtaccaagtccgacagcatcacct
agtggacaactcgaaatggaatttttgaaaaggaaaagagaagacaatgacgaaagtccg
tcagaaaataagagggttaaggatcatggcactgaaagtgaaacgccaactgattctttt
acaccacctccccctcctccgccgccgcccgaggaaggtatgcctatattggggtcagaa
gatcctgagatggctaatggtaatgggcaaattgtaagtgaggaagaggtgaaggaagaa
acagaagaggagagagagttgaggatgcaagaagaggatctgatgagggagaacgaagag
gctatgaagatggagatggaagtagaatcagttggaaggttaaaggatggcgatgactcc
aatcagcacattaacggtgaaaacatggatagacatgatgagacgatgaagagtattgat
ggaagtggtcatgaagcaatttcaacgattaattaa

DBGET integrated database retrieval system