KEGG   Sclerotinia sclerotiorum: SS1G_07292Help
Entry
SS1G_07292        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SS1G_07292
  Replication and repair
   03420 Nucleotide excision repair
    SS1G_07292
Transcription machinery [BR:ssl03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SS1G_07292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MSTEDARYRTSTQYRHWSYTPSALRSLRESTNALATIQVRDAVRRAREARAASSNDNSEA
ENSRSNSTALPEGDVDCLTVDEELKLMDYYCRQTLQLGDHLGVPIEVKATAIQYIRRFYI
SHSLMTYSPTTILKTALFFSTKTENHYFRITRFASDIGKTTTEEILSSEFLLTQGIRFQF
DIRHPYRGLEGAIMELLSISTHKIPVPPELEPQRPANMQKLVLESHGVARRYLKNSALLC
DAYFHYTPSQIMLASLYLASAPLTTFYLALKSYNPSNPDTNTATSTSTHQKLLTLIKDLA
QILSSIPEEQTPEQRQEIQALVKKLRKCRNPEKADLVGLQRMKREGADGKEGGEEDEKVI
KKRKMEREQRLKEERDLFGGSLK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaagacgcccgctatcgcacttctactcaatatcgacactggtcctacaca
ccctccgcactccgctccttgcgcgaaagcacaaatgccctagccacaatacaagttcga
gatgccgttcgacgcgcccgagaagccagggctgcatcctcaaatgataacagtgaagcg
gagaatagcaggtcgaatagcactgctttgccagagggcgatgtggattgtttgaccgtg
gatgaggagttgaagttgatggactattattgtaggcagacgctacaattgggggatcat
ttgggtgtgccgattgaagttaaggccaccgcaatccaatacatccgtcggttctatata
agccacagtctaatgacatattctcccaccactattctaaaaaccgccctcttcttctct
acaaaaaccgaaaatcactatttccgcatcaccagattcgccagcgacatcggcaaaacc
accaccgaagaaattctctcctcagaattcctcctcacccaaggaatccgcttccaattc
gacatccgacacccctaccgcggtcttgaaggagcaatcatggaactcctctccatctcc
acccacaaaatccccgtcccgcccgaactggaaccgcaacgacctgccaacatgcaaaaa
ctagtattagaaagccacggagtcgcacgccgatatctcaaaaatagcgctctactatgc
gatgcctatttccactacaccccctcccaaataatgctcgcatctctctacctcgcttca
gcccccttaacaacattctacctcgctcttaaatcctacaatccctccaacccagatacg
aacaccgcgacatcaacatcaactcaccaaaaactcctcacactaatcaaagacctcgct
caaattctatcctcgatcccggaagaacaaactcccgaacagagacaagagatccaagcc
ttagttaagaaattgaggaaatgtcgaaatcccgaaaaagcagatttagtcgggctacag
aggatgaaacgagaaggagcagatggaaaagaaggaggcgaagaagacgagaaggttatt
aaaaagaggaagatggaacgtgagcagagactaaaagaggagcgcgatctatttggaggg
agcttgaaatga

DBGET integrated database retrieval system