KEGG   Sclerotinia sclerotiorum: SS1G_07525Help
Entry
SS1G_07525        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ssl  Sclerotinia sclerotiorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 581 aa AA seqDB search
MATTVDTMTLSDRQRKPKDPNLPPENERYLRACSDIASALVQDHESQQDPNVPRKDINLN
SLRAKMSKRHRLSNIPPLTAIIAAIPEHYKKYILPKLIAKPIRSASGIAVVAVMCKPHRC
PHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLG
HSVDKVEYIIMGGTFMSLSESYRDGFISQLHNALSGYQGNNVDEAVQAGEMSNIKCVGIT
IETRPDYCLQPHLSAMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGF
KVVSHMMPDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKN
YTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALSRMKDFGTTCR
DVRTREVGINEVKNKIRPSQVELVRRDYTANKGWETFLAYEDPKQDILIGLLRLRKCSST
HTFRPELTGQPTSIIRELHVYGSAVPVHARDPRKFQHQGYGTLLMEEAERIARNEHGSTK
ISVISGVGTRDYYRRLGYWLDGPYMSKMLPPKDDEDSDDDF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggtcgatactatgactttgtcagatcggcagaggaagccaaaggatcct
aatctacctccggagaatgaacgatacttgagagcgtgttcagatattgcgagcgcttta
gtacaggatcatgaatctcaacaggatccaaatgtaccaaggaaggacatcaatttgaat
agtttacgcgccaaaatgtccaaacgtcacaggctcagcaatattccaccattaactgct
atcattgccgccattccagaacattataagaaatatatccttccaaagttgatcgcaaaa
cccattaggagtgcttctggtattgcagttgtcgcagttatgtgtaaaccacatcgatgt
cctcatatcgcatacacaggaaacatttgcgtctattgccctggtgggcctgattctgat
ttcgaatattctacacaatcgtacaccggttacgaacctacttcgatgagagctattcga
gcacgatacgatcctttcgaacaggctagaggacgggtagatcaaatcaagtctttgggt
cacagtgtcgacaaggttgaatatatcattatgggcggaactttcatgtcattatctgaa
agttacagagatgggtttatctcccaattacacaatgcgcttagtggataccagggaaac
aatgtcgatgaagcagttcaagctggagagatgagcaacattaaatgtgtcggtattaca
atcgaaacacgaccggattactgtctgcagccacatttatctgccatgttgaggtatggc
tgtacccgtttggaaattggtgtacaatctctatatgaggatgtcgctcgagataccaat
agaggtcacactgttgctgcggtcgcagaaacattttgcttagcgaaggatgctggtttc
aaagttgttagccatatgatgccagatttacctaatgtcggaatggagagagacttggat
caattcagagaatatttcgaaaatccagccttcagaaccgacggtctcaaaatttaccca
acacttgtcattcgcggaactggtttatatgaactatggagaactggcagatacaagaac
tacacaccaaatgccctgattgatatagttgctcgtatcctcgctcttgtgccaccctgg
acccgtatttatcgtgttcaaagagatattccaatgcctttggttacatctggtgtcgaa
aatggaaatctccgagagcttgcattgagcagaatgaaggactttggtactacctgtcgt
gatgttcgaactcgtgaagttggtatcaatgaagtcaagaataagatccgtccttctcaa
gttgagcttgtacgaagagattataccgcgaacaaaggatgggagacatttttggcatat
gaagatccaaaacaggatatccttattggattactccgcttgagaaagtgttcctccaca
catacttttagacctgagcttactggacaacccacgagtataattcgtgagctccacgtt
tatggttcagccgtacctgttcatgctcgtgatccaaggaagttccaacatcaaggatat
ggtacattactcatggaagaggccgaaagaatcgctcgaaatgaacatgggagtacgaag
ataagtgtcatcagtggtgtcgggacgagggattattaccgaagattaggctattggctt
gatggtccttacatgagcaagatgctaccaccaaaggatgatgaggatagtgatgatgac
ttttga

DBGET integrated database retrieval system