KEGG   Sclerotinia sclerotiorum: SS1G_07558Help
Entry
SS1G_07558        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SS1G_07558
  Lipid metabolism
   00062 Fatty acid elongation
    SS1G_07558
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     SS1G_07558
Lipid biosynthesis proteins [BR:ssl01004]
 Fatty acid synthase
  Component type
   SS1G_07558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MAPITKIVSLLSSAALINALVLPESILDFPVAYDAHATVYDKNSPLPSIFNLTSSGKTRK
ITQSSDDEDDTPLPLIIWHGLGDNYKAEGLAQVGALADAIHPGTFVYNIHLDDDASADRT
ATFFGNLTLQIEKVCEDLASHPILSTAPAVDAIGFSQGGQFLRGYISRCNAPPIRSLLTF
GSQHNGISSFQSCAPADFLCRGAQTLLRSNTWSTFVQSRLVPAQYFRDPENLEPYLESSN
FLADINNERLLKNETYKSNMEKLERFVMYVFEDDTTVIPKESGWWAEVNGTEITPLKERP
IYKEDWIGLKTLDEAGKLVFKTIPGGHMTLGEDMLEKAFKEYFGPAGKKFGKKEIEWTGH
EEEL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccattaccaaaatcgtctcattgctcagcagcgcagctcttatcaacgctctc
gttcttccagaaagcattctcgactttcctgttgcgtatgatgcacatgcaactgtctac
gataagaacagccctcttccaagcatttttaatctcacctcgtccggaaagactcgcaaa
atcacacagtcatccgacgatgaagatgatactccgctgcccttgattatctggcatggc
cttggtgataactacaaggcagaggggcttgcacaagttggtgcattggccgatgctatt
caccctggaacttttgtttacaatatccatcttgatgatgatgcatccgcagacagaacg
gctaccttctttggaaatctcactcttcaaattgagaaagtctgtgaagacctcgcctcc
caccctattctttctacagctccggccgtcgatgcaatcggattttcccaaggcggccaa
ttcctccgcggttacatctcccgctgcaacgcacctccaattcgatcgctcctaaccttt
ggctcccaacacaatggcatttcatccttccaaagctgcgctcccgccgatttcctctgt
cgcggcgctcaaacccttctccgctccaatacctggtcgaccttcgtccaatcccgcctc
gtacccgcccaatacttccgagaccccgaaaatctcgaaccttacctcgagtcatccaac
ttcctcgctgacatcaacaacgagcgcctattgaaaaatgaaacatacaaatccaacatg
gaaaaactagagcgatttgtaatgtacgtcttcgaagacgacacaactgtaatccccaag
gaaagcggatggtgggctgaagttaatggaacggaaatcacaccactgaaagaaagacct
atttataaagaagattggataggcttgaagaccctagatgaggctggaaagttagtattc
aaaacgattccaggaggtcatatgaccttgggcgaggacatgttggagaaggctttcaag
gagtactttggtccggcaggaaagaagtttggcaagaaggaaatcgagtggactggacac
gaggaagaattgtaa

DBGET integrated database retrieval system