KEGG   Sclerotinia sclerotiorum: SS1G_07818Help
Entry
SS1G_07818        CDS       T01071                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00500  Starch and sucrose metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SS1G_07818
Enzymes [BR:ssl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SS1G_07818
Glycosyltransferases [BR:ssl01003]
 Polysaccharide
  Storage polysaccharide
   SS1G_07818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 5487315
NCBI-ProteinID: XP_001591193
UniProt: A0A1D9QFH6 A7ER65
Position
Unknown
AA seq 711 aa AA seqDB search
MSGKTNRDVKNHFLFEIATEVANRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNRQSAAV
EVEALTPTNPHLAATIEAMEERGIQMLYGRWLIEGAPRVLLIDTKSAYRFLDEWKADLWN
TAGIPSPPGDDETNEAVVFGYLVAWFLGEFVAHEKEKAVIAHFHEWLSGVALPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAATHSCDVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQAKEKIHDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHRLKSAGSKMTVVAFIIMPAQTQSLT
VEALKGQAVIKSLRDTVDVIERGVGKRIFERALKWHEGEVMPDDKDLITSQDRILLRRRL
FAMKRHGLPPIVTHNMANDSEDPILNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVLPMD
YDEFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSTDYGIYI
VDRRMKGVDDSVNQLTSYMFDFAGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQLA
LRRAYPASFDGEEEDDFIPGVEQKISRPFSVPGSPRDRSGMMTPGDFASLQEGREGLSTE
DYVAWKLPEEEDPDEYPFPLTLRTKKNGAQSPYGGAQSPSEYAITNGNGLR
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaaaaacaaaccgagatgtcaagaaccactttctctttgagatagctactgag
gttgcaaatcgagttggtggtatctactccgtcatcaaatcgaaagcaccagtaacgaca
gccgaatatggagacagatacaccctcatcggtcccctcaataggcaatcggccgccgtg
gaagtcgaagcattgacacctacaaatccccatctcgcagcaacgatagaggctatggaa
gaaagaggaattcaaatgttatatggccgctggttgatcgagggtgccccaagagttttg
ttaatcgacaccaagagtgcctacagatttttggacgaatggaaagccgacctgtggaat
actgcaggtattccgtctcctccgggagatgatgaaaccaacgaagcagtcgtcttcggt
tatttggttgcatggtttttgggagagttcgttgcccacgaaaaggaaaaggctgtcatc
gcgcatttccatgaatggctctctggtgtcgcacttcctctatgcaaaaagcgtcgcata
gatgttacgacaatttttaccactcacgccactttactaggaagatatctttgcgcagga
tcggtcgatttctacaacaatcttcaatggtttgatgttgatgctgaagcaggaaagcgt
ggtatttaccacaggtattgcatagaacgcgcagcaacgcattcttgtgatgttttcaca
accgtctcacacatcactgcctacgaatccgagcatttgttaaagagaaagccggatggt
gttctccccaacggtcttaacgtcaccaaattctcagccatgcacgaatttcagaacttg
catcagcaggcaaaggaaaagattcatgatttcgttagaggtcacttctatgggcacaat
gactttgatccagaaaacactttatatttcttcacggctggacgatacgagtataggaat
aagggtgtggacatgttcatagagtcgctggctcgtttgaatcaccgtctcaagtctgcc
ggatccaaaatgactgttgtagcttttatcattatgcccgcacaaactcagtcattgact
gtggaggctttgaagggacaggccgtcatcaagtcattacgtgacacagtcgatgttatt
gaacgtggtgttggaaagaggattttcgagcgtgcccttaaatggcatgagggtgaggtc
atgcctgatgataaagatttgatcaccagtcaagatcgtatccttctccgtaggcgattg
tttgccatgaagagacatggtctcccaccaatcgtcacccataacatggcaaacgactcc
gaggacccaattttgaaccagatcagaagagttcaattgttcaatcacccatccgaccgt
gtgaaggtcgttttccacccagagtttttgaactctgcaaacccagttttgccaatggac
tacgatgaattcgttagaggtactcatttgggtgttttctcatcctattatgagccatgg
ggttacacacctgcggaatgtacggtcatgggtgttccaagtatcacaactaacttgtca
ggtttcggttgttacatggaggagttgattgaaaactcgacggattacggaatttatatt
gttgacaggagaatgaagggtgtggatgattcagtcaatcagttaaccagctacatgttt
gatttcgccggcaaaagcagacgtcagcgtattaaccagaggaatcgtaccgagcgattg
agcgatcttctcgactggaagcgtatgggtatggaatacgtcaaggcaagacaacttgca
ttgagaagagcttatcctgcttctttcgatggtgaagaggaagatgacttcatccctggt
gtggaacaaaagatctcacgcccattctcagtacctggatctccaagagatagaagtgga
atgatgacacctggtgattttgccagtctacaagaaggacgtgaaggattgagcacggaa
gattatgttgcatggaagcttcctgaggaggaagacccagatgagtatccattcccgctc
acccttcgaacaaagaaaaatggtgcacaaagtccatatggtggtgcacaaagcccttcg
gaatatgcgattacaaatggaaatgggttgagataa

DBGET integrated database retrieval system