KEGG   Sclerotinia sclerotiorum: SS1G_07818Help
Entry
SS1G_07818        CDS       T01071                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SS1G_07818
Enzymes [BR:ssl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SS1G_07818
Glycosyltransferases [BR:ssl01003]
 Polysaccharide
  Storage polysaccharide
   SS1G_07818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 711 aa AA seqDB search
MSGKTNRDVKNHFLFEIATEVANRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNRQSAAV
EVEALTPTNPHLAATIEAMEERGIQMLYGRWLIEGAPRVLLIDTKSAYRFLDEWKADLWN
TAGIPSPPGDDETNEAVVFGYLVAWFLGEFVAHEKEKAVIAHFHEWLSGVALPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAATHSCDVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQAKEKIHDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHRLKSAGSKMTVVAFIIMPAQTQSLT
VEALKGQAVIKSLRDTVDVIERGVGKRIFERALKWHEGEVMPDDKDLITSQDRILLRRRL
FAMKRHGLPPIVTHNMANDSEDPILNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVLPMD
YDEFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSTDYGIYI
VDRRMKGVDDSVNQLTSYMFDFAGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQLA
LRRAYPASFDGEEEDDFIPGVEQKISRPFSVPGSPRDRSGMMTPGDFASLQEGREGLSTE
DYVAWKLPEEEDPDEYPFPLTLRTKKNGAQSPYGGAQSPSEYAITNGNGLR
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaaaaacaaaccgagatgtcaagaaccactttctctttgagatagctactgag
gttgcaaatcgagttggtggtatctactccgtcatcaaatcgaaagcaccagtaacgaca
gccgaatatggagacagatacaccctcatcggtcccctcaataggcaatcggccgccgtg
gaagtcgaagcattgacacctacaaatccccatctcgcagcaacgatagaggctatggaa
gaaagaggaattcaaatgttatatggccgctggttgatcgagggtgccccaagagttttg
ttaatcgacaccaagagtgcctacagatttttggacgaatggaaagccgacctgtggaat
actgcaggtattccgtctcctccgggagatgatgaaaccaacgaagcagtcgtcttcggt
tatttggttgcatggtttttgggagagttcgttgcccacgaaaaggaaaaggctgtcatc
gcgcatttccatgaatggctctctggtgtcgcacttcctctatgcaaaaagcgtcgcata
gatgttacgacaatttttaccactcacgccactttactaggaagatatctttgcgcagga
tcggtcgatttctacaacaatcttcaatggtttgatgttgatgctgaagcaggaaagcgt
ggtatttaccacaggtattgcatagaacgcgcagcaacgcattcttgtgatgttttcaca
accgtctcacacatcactgcctacgaatccgagcatttgttaaagagaaagccggatggt
gttctccccaacggtcttaacgtcaccaaattctcagccatgcacgaatttcagaacttg
catcagcaggcaaaggaaaagattcatgatttcgttagaggtcacttctatgggcacaat
gactttgatccagaaaacactttatatttcttcacggctggacgatacgagtataggaat
aagggtgtggacatgttcatagagtcgctggctcgtttgaatcaccgtctcaagtctgcc
ggatccaaaatgactgttgtagcttttatcattatgcccgcacaaactcagtcattgact
gtggaggctttgaagggacaggccgtcatcaagtcattacgtgacacagtcgatgttatt
gaacgtggtgttggaaagaggattttcgagcgtgcccttaaatggcatgagggtgaggtc
atgcctgatgataaagatttgatcaccagtcaagatcgtatccttctccgtaggcgattg
tttgccatgaagagacatggtctcccaccaatcgtcacccataacatggcaaacgactcc
gaggacccaattttgaaccagatcagaagagttcaattgttcaatcacccatccgaccgt
gtgaaggtcgttttccacccagagtttttgaactctgcaaacccagttttgccaatggac
tacgatgaattcgttagaggtactcatttgggtgttttctcatcctattatgagccatgg
ggttacacacctgcggaatgtacggtcatgggtgttccaagtatcacaactaacttgtca
ggtttcggttgttacatggaggagttgattgaaaactcgacggattacggaatttatatt
gttgacaggagaatgaagggtgtggatgattcagtcaatcagttaaccagctacatgttt
gatttcgccggcaaaagcagacgtcagcgtattaaccagaggaatcgtaccgagcgattg
agcgatcttctcgactggaagcgtatgggtatggaatacgtcaaggcaagacaacttgca
ttgagaagagcttatcctgcttctttcgatggtgaagaggaagatgacttcatccctggt
gtggaacaaaagatctcacgcccattctcagtacctggatctccaagagatagaagtgga
atgatgacacctggtgattttgccagtctacaagaaggacgtgaaggattgagcacggaa
gattatgttgcatggaagcttcctgaggaggaagacccagatgagtatccattcccgctc
acccttcgaacaaagaaaaatggtgcacaaagtccatatggtggtgcacaaagcccttcg
gaatatgcgattacaaatggaaatgggttgagataa

DBGET integrated database retrieval system