KEGG   Sclerotinia sclerotiorum: SS1G_07827Help
Entry
SS1G_07827        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ssl  Sclerotinia sclerotiorum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SS1G_07827
Translation factors [BR:ssl03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SS1G_07827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 342 aa AA seqDB search
MDNLWTRRSNSSKLSLSTGNPTTNGSTFNGGDHPTRGFALGRRNGDTSSHSTKNPFNSMS
PSASSLSSPTTGASSAFGLGSGAFASFGSAKGPKTPGGGGVLDFGSVVGGSTKTPTAEKN
YRDLGSKASKISLTDSKTVTTPLSHQFRHGWVFWYRPPISKSNGFVEYEKTLHPMAVFNS
AEELFDVFDHMRHPSDLPLVSDYHMFKKGIRPVWEDDENKKGGKWIVRLKKGVADRYWED
LVFAMAGDEFDPSEEVCGVVLSVRNGEDILSIWTRSGGGRVLKIRETLKRVLSFPPETKV
EWKSHDSSIQQRTAIDEARKEKAANHHNNRNGNEHTEKKQTS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggataacctgtggactcgacgttcgaattccagcaaactttcgctatccacaggaaat
ccaactacgaatggatcaactttcaatggtggcgaccacccgacaagaggattcgctttg
ggtagaagaaatggagatacctcctcgcatagcacaaagaatcctttcaattccatgtcc
ccttcggcctcgtctttatcctccccaacaactggcgcatcgagcgcctttggcttagga
tcaggcgctttcgcatcatttggaagtgcaaagggtccgaagacacctgggggtggaggc
gtattggattttggaagtgtggtgggaggatctaccaaaacaccaaccgcagagaaaaat
tatagagacttgggatcaaaggcctctaaaatttctctcacagattctaagacggtcaca
acaccactttctcatcaatttagacatggttgggtattctggtacagacccccaatctcc
aaatcaaatggattcgtggaatatgaaaagacattacatccaatggcagtattcaattcg
gcggaggaattgttcgatgttttcgatcatatgaggcacccgtcagatctgccactggtt
tccgattaccacatgtttaaaaagggaattcgccctgtttgggaggatgatgaaaataaa
aaaggaggcaaatggatcgtgagacttaagaagggtgtggccgatcgttattgggaggac
ttagtctttgcaatggcaggagatgaattcgatcctagtgaggaggtttgcggtgttgta
cttagcgtacgcaatggtgaagatattttgagtatctggactcgttcaggtggcggaagg
gtacttaagattagggagacattgaagcgtgttctttcattcccacccgaaaccaaggta
gaatggaaatctcatgattctagcatacaacaacgaactgctattgatgaagctcgaaag
gaaaaagctgccaatcatcacaataatcgtaatggcaacgaacacacagagaagaaacaa
acatcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system