KEGG   Sclerotinia sclerotiorum: SS1G_08114Help
Entry
SS1G_08114        CDS       T01071                                 

Definition
similar to mutant tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SS1G_08114
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SS1G_08114
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SS1G_08114
Enzymes [BR:ssl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SS1G_08114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 725 aa AA seqDB search
MEHLKNTFAQCKKEGRSALVTYITAGFPQADDTVDILLGMEAGGADVIELGIPFTDPTAD
GPTIQKANTQALKNGVTVTSVLQMVRDARKKGLRAPVLFMGYYNPFLSYGEERLLQDCRE
AGVNGFIVCDLPPEEAVSFRKFCTSGGLSYVPLIAPSTSESRMKLLCKLADSFIYVVSRM
GVTGATGGSMDAGLEGLLKRVKDYSGNVPAAVGFGVSTREHFLQVAKIADGVVIGSQIIN
TVNQAPAGKIAKSVEEYCAAVCGRRGTPNEGLTREVGMAEAIDVAEEPSGENVTVDAVIR
DEDRSGPGLADQIEALNTNGSLDPKLSAQKFGEFGGQYVPEALMDCLSELEAGFNAIKDD
PAFWEEYRTYYPWMGRPGQLHEAERLTEYAGGARIWLKREDLNHTGSHKINNALGQILLA
RRLGKTEIIAETGAGQHGVATATVCAKFGMKCTIYMGAEDVRRQALNVFRIKLLGASVVA
VEAGSRTLRDAVNEAMRSWVVKLDTTHYIIGSAIGPHPFPTIVRTFQSVIGNETRAQMLE
KRGKLPDAVVACVGGGSNAVGMFYPFSKDPSVKLLGVEAGGDGLDTDRHSATLSGGTKGV
LHGVRTYVLQDKHGQISETHSVSAGLDYPGVGPELSNWKDSERAKFIAATDAEAFKGFRL
ISEKEGIIPALETAHAVWGAVELAKTMNKDQDVVICLSGRGDKDVQSVAEELPKLGPAIG
WDLRF
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctcaagaatacatttgcacaatgcaagaaagaaggaagatccgcgttggta
acatatatcactgctggttttcctcaagcagatgacaccgttgatatcctattaggaatg
gaggctggtggcgccgatgtcattgaattaggaattcctttcacagatcccacggcagat
ggaccaacgattcaaaaggcaaacactcaagcattgaaaaatggtgtgactgtcacttcg
gttttacagatggtacgggatgcaagaaagaaaggattacgggcaccagttcttttcatg
ggttattacaacccatttctgagttatggagaggaaaggttattgcaagactgtcgtgaa
gctggtgtcaatggtttcattgtttgtgatcttccacctgaagaagctgtgagcttcagg
aagttttgcacaagcggaggattatcctacgttcctctcatcgctccctcaacatccgaa
tcacgaatgaagcttctttgtaagcttgcggactccttcatctatgttgtttcaagaatg
ggtgtgaccggagccacaggaggctcaatggatgctggcttagaaggattgctgaaaaga
gtaaaagattattcgggaaatgttccagcggccgtgggttttggcgttagcacaagagag
cactttttgcaggtcgcaaaaatcgcagatggagttgttattggcagtcaaatcatcaac
accgtcaatcaagcacctgccggaaaaatcgcgaaaagtgtggaagagtactgtgcagca
gtttgcggcagacgaggtactccgaacgagggtttaaccagggaagttggcatggccgag
gcaatagatgttgccgaagaacctagcggagaaaatgtcaccgttgatgctgtcattaga
gatgaagatagatccggacctggtttagcagatcagattgaagccttgaacacgaatggt
tctctagatccaaaactttcggctcaaaagttcggcgaatttggtggacagtatgtaccg
gaggcactcatggactgcttgtcagaacttgaagcaggattcaatgctatcaaggatgat
ccagcattctgggaagaataccgaacatattacccatggatgggacgaccaggccaatta
cacgaggctgaaagacttactgagtatgctggtggtgccaggatctggttgaagagagag
gacctgaaccacaccggaagtcataagattaacaatgctcttggacaaatccttctcgcc
cgacgattagggaaaaccgagatcatcgcagagactggtgcaggacaacacggtgtggcc
acagcgacagtatgcgcaaagtttggtatgaaatgtaccatttatatgggagcggaagat
gtaagaagacaggctctcaatgtttttagaatcaagcttctcggtgcttcagttgtcgcc
gtcgaggctggttcgcgtactcttagagatgctgtcaacgaagctatgcgctcctgggtg
gtcaaacttgatactactcattacatcattggttcagcaattggtcctcatccattccca
accatcgttagaacattccaatccgttattggtaacgagactcgagctcaaatgctagag
aaacgcggtaaactccctgatgctgtcgttgcatgtgtcggaggcggtagtaatgcagtt
ggcatgttctacccgttctcgaaagatccaagtgtcaaattattaggtgttgaagccggt
ggtgatggtttagacacagatcgtcattccgctaccctgagtggtgggacaaagggtgtt
ctacatggtgtccgtacatatgttcttcaggacaaacacggacaaatctcagagactcat
tccgtttctgccggtttagattatccaggtgttggaccagaattaagtaattggaaagat
agtgagcgtgccaaattcatcgcggcaacagatgccgaggcattcaagggattcaggttg
atcagtgagaaagagggtatcataccggctttggagactgcgcatgccgtgtggggagca
gtagaactggcgaaaaccatgaacaaggatcaagatgttgttatttgtttaagtggtaga
ggtgataaggatgtacagagtgttgcagaggaattacccaagttgggtccagcgattgga
tgggatttgagattttag

DBGET integrated database retrieval system