KEGG   Sclerotinia sclerotiorum: SS1G_08114Help
Entry
SS1G_08114        CDS       T01071                                 

Definition
(RefSeq) similar to mutant tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SS1G_08114
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SS1G_08114
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SS1G_08114
Enzymes [BR:ssl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SS1G_08114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 725 aa AA seqDB search
MEHLKNTFAQCKKEGRSALVTYITAGFPQADDTVDILLGMEAGGADVIELGIPFTDPTAD
GPTIQKANTQALKNGVTVTSVLQMVRDARKKGLRAPVLFMGYYNPFLSYGEERLLQDCRE
AGVNGFIVCDLPPEEAVSFRKFCTSGGLSYVPLIAPSTSESRMKLLCKLADSFIYVVSRM
GVTGATGGSMDAGLEGLLKRVKDYSGNVPAAVGFGVSTREHFLQVAKIADGVVIGSQIIN
TVNQAPAGKIAKSVEEYCAAVCGRRGTPNEGLTREVGMAEAIDVAEEPSGENVTVDAVIR
DEDRSGPGLADQIEALNTNGSLDPKLSAQKFGEFGGQYVPEALMDCLSELEAGFNAIKDD
PAFWEEYRTYYPWMGRPGQLHEAERLTEYAGGARIWLKREDLNHTGSHKINNALGQILLA
RRLGKTEIIAETGAGQHGVATATVCAKFGMKCTIYMGAEDVRRQALNVFRIKLLGASVVA
VEAGSRTLRDAVNEAMRSWVVKLDTTHYIIGSAIGPHPFPTIVRTFQSVIGNETRAQMLE
KRGKLPDAVVACVGGGSNAVGMFYPFSKDPSVKLLGVEAGGDGLDTDRHSATLSGGTKGV
LHGVRTYVLQDKHGQISETHSVSAGLDYPGVGPELSNWKDSERAKFIAATDAEAFKGFRL
ISEKEGIIPALETAHAVWGAVELAKTMNKDQDVVICLSGRGDKDVQSVAEELPKLGPAIG
WDLRF
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctcaagaatacatttgcacaatgcaagaaagaaggaagatccgcgttggta
acatatatcactgctggttttcctcaagcagatgacaccgttgatatcctattaggaatg
gaggctggtggcgccgatgtcattgaattaggaattcctttcacagatcccacggcagat
ggaccaacgattcaaaaggcaaacactcaagcattgaaaaatggtgtgactgtcacttcg
gttttacagatggtacgggatgcaagaaagaaaggattacgggcaccagttcttttcatg
ggttattacaacccatttctgagttatggagaggaaaggttattgcaagactgtcgtgaa
gctggtgtcaatggtttcattgtttgtgatcttccacctgaagaagctgtgagcttcagg
aagttttgcacaagcggaggattatcctacgttcctctcatcgctccctcaacatccgaa
tcacgaatgaagcttctttgtaagcttgcggactccttcatctatgttgtttcaagaatg
ggtgtgaccggagccacaggaggctcaatggatgctggcttagaaggattgctgaaaaga
gtaaaagattattcgggaaatgttccagcggccgtgggttttggcgttagcacaagagag
cactttttgcaggtcgcaaaaatcgcagatggagttgttattggcagtcaaatcatcaac
accgtcaatcaagcacctgccggaaaaatcgcgaaaagtgtggaagagtactgtgcagca
gtttgcggcagacgaggtactccgaacgagggtttaaccagggaagttggcatggccgag
gcaatagatgttgccgaagaacctagcggagaaaatgtcaccgttgatgctgtcattaga
gatgaagatagatccggacctggtttagcagatcagattgaagccttgaacacgaatggt
tctctagatccaaaactttcggctcaaaagttcggcgaatttggtggacagtatgtaccg
gaggcactcatggactgcttgtcagaacttgaagcaggattcaatgctatcaaggatgat
ccagcattctgggaagaataccgaacatattacccatggatgggacgaccaggccaatta
cacgaggctgaaagacttactgagtatgctggtggtgccaggatctggttgaagagagag
gacctgaaccacaccggaagtcataagattaacaatgctcttggacaaatccttctcgcc
cgacgattagggaaaaccgagatcatcgcagagactggtgcaggacaacacggtgtggcc
acagcgacagtatgcgcaaagtttggtatgaaatgtaccatttatatgggagcggaagat
gtaagaagacaggctctcaatgtttttagaatcaagcttctcggtgcttcagttgtcgcc
gtcgaggctggttcgcgtactcttagagatgctgtcaacgaagctatgcgctcctgggtg
gtcaaacttgatactactcattacatcattggttcagcaattggtcctcatccattccca
accatcgttagaacattccaatccgttattggtaacgagactcgagctcaaatgctagag
aaacgcggtaaactccctgatgctgtcgttgcatgtgtcggaggcggtagtaatgcagtt
ggcatgttctacccgttctcgaaagatccaagtgtcaaattattaggtgttgaagccggt
ggtgatggtttagacacagatcgtcattccgctaccctgagtggtgggacaaagggtgtt
ctacatggtgtccgtacatatgttcttcaggacaaacacggacaaatctcagagactcat
tccgtttctgccggtttagattatccaggtgttggaccagaattaagtaattggaaagat
agtgagcgtgccaaattcatcgcggcaacagatgccgaggcattcaagggattcaggttg
atcagtgagaaagagggtatcataccggctttggagactgcgcatgccgtgtggggagca
gtagaactggcgaaaaccatgaacaaggatcaagatgttgttatttgtttaagtggtaga
ggtgataaggatgtacagagtgttgcagaggaattacccaagttgggtccagcgattgga
tgggatttgagattttag

DBGET integrated database retrieval system