KEGG   Sclerotinia sclerotiorum: SS1G_08177Help
Entry
SS1G_08177        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SS1G_08177
Enzymes [BR:ssl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SS1G_08177
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SS1G_08177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 392 aa AA seqDB search
MSFSSLVQDLSFRDAASERRPPIRGAASVSTYDDRASYVSRADSHISRARSYASTTATSV
SISGDIASQLHGGYCHPLARTWQAERQLTKSMLIYPLFISDIDDEETLIPSLPDQHRRGI
NKVVPFLEPLVRKGLRSVILFGVPVAPNAKDALGTSADDPQGPVIATIRLLRQRFPQLFI
VADVCLCEYTSHGHCGILRDDGSLNNQLSVDRVSDVAIAYAQAGAHCVAPSDMNDGRIRA
IKLKLIEEGIAHKVVLMSYAAKFSGCLYGPFRDAAGSVPSFGDRKCYQLPPGARGLARRA
VERDIGEGADIIMVKPASQYLDIISDAKDIGKNMPIAAYQVSGEFAMIHAGAKAGVFDLK
EMALESTEGILRAGATIIVSYFTPQLLDWLES
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctctagtctcgtacaagatttatcatttagagatgctgctagtgagcgacga
ccaccaattcgaggtgcggcatcggtttcgacttatgatgatcgtgcatcttacgtttct
agagccgactcgcacatttccagagccaggtcatacgcaagcacgacggcgacgagcgtg
agcatatctggagatattgctagtcaattgcacggtggttactgtcatcctttggcaaga
acatggcaggctgagagacaattgacaaagtcaatgcttatttaccccctgtttatctcc
gacattgatgacgaagaaacccttatcccctcccttcccgatcaacaccgtcgaggaatc
aacaaggttgtgccattcctggaacctcttgtccgcaagggtttgagatcagtcatatta
ttcggtgtaccggttgcgcctaatgccaaagacgctctcggaacaagcgcagatgatcca
cagggtccagtcattgctacaattcgactcctccgtcagcgatttccacaactcttcatc
gtggcagatgtctgcctttgcgaatacacctcccacggacattgcggtattttgagggat
gatggtagtcttaacaaccagttgtctgtcgaccgtgtctcagatgttgcgatcgcatat
gctcaagctggtgcgcattgcgttgctccttcagatatgaatgacggtcgcattcgtgct
atcaagctcaagttgatcgaggagggcattgcacacaaagtcgtattgatgtcatacgct
gctaagttctctggctgcttatacggaccattccgtgacgcagcaggctctgttccttca
tttggcgaccgaaaatgctatcaattaccaccaggagctcgtggtcttgctcgtagagcc
gttgaaagagatatcggtgaaggcgcagacattatcatggtcaagccagctagccaatat
ctcgatattattagtgatgcaaaggacatcggaaaaaatatgcctatcgcagcatatcaa
gttagtggggaatttgcgatgattcatgctggcgcaaaggctggtgtttttgacttgaag
gaaatggctcttgagtctactgaaggtattctgagagctggtgcgaccatcattgtcagc
tatttcacaccacaattactcgattggttagagtcatag

DBGET integrated database retrieval system