KEGG   Sclerotinia sclerotiorum: SS1G_08315Help
Entry
SS1G_08315        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ssl  Sclerotinia sclerotiorum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SS1G_08315
   03420 Nucleotide excision repair
    SS1G_08315
   03430 Mismatch repair
    SS1G_08315
   03440 Homologous recombination
    SS1G_08315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 287 aa AA seqDB search
MSNNYTYQNNYSTTTYGAQGGADGGGFVQGGYGGSQGGSQDSPGGTKTYGKDTLRPVTIK
QILDAEQPHPDADFKIDGSEVTQLSFIGQVHSISTQATNNTYKVDDGTGLIEVKQWIDND
AEPENAKSVPQEGQYIHVWGRLKSFHDKRHVGAHIIRPVTDMNEVTFHGLEATLVHLHFT
RGPIPTAGAGAVKTESGDGMFVDSYGGNNVSTATGGRVLAAHVTPNSRAVFNLLQLEPQN
NEGLNVNVIATKLGMPVAEVYKCGDQLLSEGCIYTTVDDETWAILEY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaattacacataccaaaataattattctaccaccacgtacggcgcacaaggc
ggggctgatggcggcggatttgttcaaggaggatatggtggatcgcagggaggaagtcaa
gatagtcctggaggaacaaagacatatggcaaagatactttgcgaccggtaaccatcaag
caaatccttgatgctgagcagccacatccggatgcagatttcaaaatcgatggatcagaa
gtaactcagctctcattcatcggccaagtccactccatctccacgcaagctacaaataat
acctacaaagttgacgacggcaccggcctcattgaagtaaagcaatggatcgacaatgac
gctgagcccgaaaacgcaaaatctgttccgcaagaaggtcaatatatacacgtgtggggt
cgtctcaaatcattccacgataaacgtcacgtaggagctcatattatccgacccgttacc
gacatgaacgaagttacattccacggactagaagctacattggtacatttacatttcaca
cggggtcctattcctaccgcaggcgcaggcgcggtgaagacagagagcggcgatggaatg
tttgttgattcatacggtggtaacaatgtcagcacagctaccggtggtagagtattagcc
gcgcatgtaacgcctaattcgagagcggtattcaacttattacaattggagcctcaaaac
aacgagggtcttaatgtaaatgtaattgcaaccaagcttggcatgccagtcgcagaggtc
tataaatgtggggatcagctattatcggagggctgcatctacacaacggttgacgatgag
acatgggctatattggagtactag

DBGET integrated database retrieval system