KEGG   Sclerotinia sclerotiorum: SS1G_08315Help
Entry
SS1G_08315        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl03030  DNA replication
ssl03420  Nucleotide excision repair
ssl03430  Mismatch repair
ssl03440  Homologous recombination
Module
ssl_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SS1G_08315
   03420 Nucleotide excision repair
    SS1G_08315
   03430 Mismatch repair
    SS1G_08315
   03440 Homologous recombination
    SS1G_08315
DNA replication proteins [BR:ssl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    SS1G_08315
DNA repair and recombination proteins [BR:ssl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     SS1G_08315
   MMR (mismatch exicision repair)
     SS1G_08315
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     SS1G_08315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2
Motif
Other DBs
NCBI-GeneID: 5486859
NCBI-ProteinID: XP_001590575
UniProt: A7ESL0 A0A1D9QDJ7
Position
Unknown
AA seq 287 aa AA seqDB search
MSNNYTYQNNYSTTTYGAQGGADGGGFVQGGYGGSQGGSQDSPGGTKTYGKDTLRPVTIK
QILDAEQPHPDADFKIDGSEVTQLSFIGQVHSISTQATNNTYKVDDGTGLIEVKQWIDND
AEPENAKSVPQEGQYIHVWGRLKSFHDKRHVGAHIIRPVTDMNEVTFHGLEATLVHLHFT
RGPIPTAGAGAVKTESGDGMFVDSYGGNNVSTATGGRVLAAHVTPNSRAVFNLLQLEPQN
NEGLNVNVIATKLGMPVAEVYKCGDQLLSEGCIYTTVDDETWAILEY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaattacacataccaaaataattattctaccaccacgtacggcgcacaaggc
ggggctgatggcggcggatttgttcaaggaggatatggtggatcgcagggaggaagtcaa
gatagtcctggaggaacaaagacatatggcaaagatactttgcgaccggtaaccatcaag
caaatccttgatgctgagcagccacatccggatgcagatttcaaaatcgatggatcagaa
gtaactcagctctcattcatcggccaagtccactccatctccacgcaagctacaaataat
acctacaaagttgacgacggcaccggcctcattgaagtaaagcaatggatcgacaatgac
gctgagcccgaaaacgcaaaatctgttccgcaagaaggtcaatatatacacgtgtggggt
cgtctcaaatcattccacgataaacgtcacgtaggagctcatattatccgacccgttacc
gacatgaacgaagttacattccacggactagaagctacattggtacatttacatttcaca
cggggtcctattcctaccgcaggcgcaggcgcggtgaagacagagagcggcgatggaatg
tttgttgattcatacggtggtaacaatgtcagcacagctaccggtggtagagtattagcc
gcgcatgtaacgcctaattcgagagcggtattcaacttattacaattggagcctcaaaac
aacgagggtcttaatgtaaatgtaattgcaaccaagcttggcatgccagtcgcagaggtc
tataaatgtggggatcagctattatcggagggctgcatctacacaacggttgacgatgag
acatgggctatattggagtactag

DBGET integrated database retrieval system