KEGG   Sclerotinia sclerotiorum: SS1G_08337Help
Entry
SS1G_08337        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SS1G_08337
Enzymes [BR:ssl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     SS1G_08337
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SS1G_08337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 222 aa AA seqDB search
MNVGENKGAIVTNIIREKKPEIMVELGGYCGYSTILFASAVRAAGGKKYYSLERSPKFAK
IISALVSFAGLEGFVEVVVGPSNEGIQKLHSRGLKTIDMMFLDHYKPAYTTDLKLCEQLG
LIKEGTVLAADNVISPGNPPYLEYVRSTVEKKVENLKQEGKLDTDGFAKRSATQYGGVEA
LDTEIKGNPNLIYESQLINSFEPTGEPDGVEITRCMGKVEGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgggggagaacaaaggagcaattgttaccaatataatcagagaaaagaaacct
gaaataatggtcgagctaggaggatattgcggatattccacgatacttttcgcatccgca
gtacgagctgcgggagggaagaagtattactcgttagagagaagtccaaagttcgcgaaa
attatcagtgcgctggtgagttttgctggtcttgaaggatttgttgaggtggtcgttggt
cctagcaacgagggaatacaaaaactacattcccgtggattgaagaccattgatatgatg
tttctagatcattataagccagcgtacacgactgacctgaagttgtgtgaacaattgggt
ttgatcaaggaaggaaccgttctcgctgccgataatgttattagtccaggaaaccctcca
tacttagaatatgtacgaagcactgtggagaaaaaggtagaaaatctaaagcaggagggg
aagttagatactgatggatttgcgaaacgatccgcaactcaatatggtggagttgaggcg
ttggacaccgaaatcaaaggcaatcccaacctcatatatgagagccaactgatcaacagc
ttcgagcctactggagaaccagatggagtagagataacgcgatgtatggggaaagtcgaa
ggagcttga

DBGET integrated database retrieval system