KEGG   Sclerotinia sclerotiorum: SS1G_08575Help
Entry
SS1G_08575        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11092  
U2 small nuclear ribonucleoprotein A'
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:ssl03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 267 aa AA seqDB search
MRLTADLIQSSLSYLNPLKERELDLRGHKIPAVENLGVAGPHDAIDFTDNDIQVLGNFPL
SPRLRTLLLARNRVSSISPTLSKSLPNLTTLVLTSNNVAELADLDALAGCARLTSLVLME
NPVTRKEHYREWVLFRCPNVRFLDYKKVKAAERERAQELFGTSAEPSTLASKVNISLSSF
PLVILPTWFLQIMGIKSRTFDTTSTTNGASASSTSKSYRVKLTDKERKKVEELIKNAKSL
QEIIKLEKELNEGRVPAAAQGDDPMEQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttacagcggacctaatccaatcctccctctcctacctcaatccgctcaaggaa
cgcgaattagatcttcgaggtcataagattccggcggtggagaatttgggggttgcgggg
ccacacgatgcaattgatttcacagacaatgatatccaagttctgggcaacttccccctc
agtccacgtctaagaactcttctcctagctcgcaatcgcgtctcgagtatctcacctaca
ttgtcgaaatcattaccaaatctgacgacgttggttttgacaagtaataatgtggcagag
ttggcagatttggatgcattggctgggtgtgcgaggttgacgagtttggttttgatggag
aatcctgtgactaggaaggagcattatagggaatgggtcctatttcgatgtccaaatgtg
agatttttggattataagaaagtcaaagctgcagagcgagaaagagcgcaagaattattt
ggtacatctgcagaaccatctactcttgcatcgaaggtaaacatctctttatcctccttt
cccctcgtcattttaccaacatggttcctccagattatgggcatcaaatctcgcacattc
gatacaaccagcacgactaatggcgcttctgcatcctcaacatccaaatcctaccgcgtc
aagcttaccgataaagaacgaaagaaggtcgaagaattaatcaagaatgcaaagagtttg
caggagattatcaaactagagaaagagttgaatgaaggaagggttccagctgccgcgcag
ggcgatgatccaatggagcaataa

DBGET integrated database retrieval system