KEGG   Sclerotinia sclerotiorum: SS1G_08575Help
Entry
SS1G_08575        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11092  
U2 small nuclear ribonucleoprotein A'
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    SS1G_08575
Spliceosome [BR:ssl03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    SS1G_08575
 Complex B
    SS1G_08575
 Complex C
   U2 SnRNP specific factors
    SS1G_08575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 267 aa AA seqDB search
MRLTADLIQSSLSYLNPLKERELDLRGHKIPAVENLGVAGPHDAIDFTDNDIQVLGNFPL
SPRLRTLLLARNRVSSISPTLSKSLPNLTTLVLTSNNVAELADLDALAGCARLTSLVLME
NPVTRKEHYREWVLFRCPNVRFLDYKKVKAAERERAQELFGTSAEPSTLASKVNISLSSF
PLVILPTWFLQIMGIKSRTFDTTSTTNGASASSTSKSYRVKLTDKERKKVEELIKNAKSL
QEIIKLEKELNEGRVPAAAQGDDPMEQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttacagcggacctaatccaatcctccctctcctacctcaatccgctcaaggaa
cgcgaattagatcttcgaggtcataagattccggcggtggagaatttgggggttgcgggg
ccacacgatgcaattgatttcacagacaatgatatccaagttctgggcaacttccccctc
agtccacgtctaagaactcttctcctagctcgcaatcgcgtctcgagtatctcacctaca
ttgtcgaaatcattaccaaatctgacgacgttggttttgacaagtaataatgtggcagag
ttggcagatttggatgcattggctgggtgtgcgaggttgacgagtttggttttgatggag
aatcctgtgactaggaaggagcattatagggaatgggtcctatttcgatgtccaaatgtg
agatttttggattataagaaagtcaaagctgcagagcgagaaagagcgcaagaattattt
ggtacatctgcagaaccatctactcttgcatcgaaggtaaacatctctttatcctccttt
cccctcgtcattttaccaacatggttcctccagattatgggcatcaaatctcgcacattc
gatacaaccagcacgactaatggcgcttctgcatcctcaacatccaaatcctaccgcgtc
aagcttaccgataaagaacgaaagaaggtcgaagaattaatcaagaatgcaaagagtttg
caggagattatcaaactagagaaagagttgaatgaaggaagggttccagctgccgcgcag
ggcgatgatccaatggagcaataa

DBGET integrated database retrieval system