KEGG   Sclerotinia sclerotiorum: SS1G_08803Help
Entry
SS1G_08803        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SS1G_08803
   00670 One carbon pool by folate
    SS1G_08803
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SS1G_08803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 215 aa AA seqDB search
MAPIKEFTLIVAATNKMGVGKGGGLPWTGLRKEMAYFARVTKRAGPGKTNAVVMGRKTWE
SIPPKFRPLANRANYMISRTQTSNSPEVDLGPDAHSATSLTDALEKLGSRAQSNTNHEDE
KEIDRVFIIGGGQIYKASLELKEAKRILLTRILEDFECDTYFPVELKEDGTGKGWRRTDT
QALREWTGEGEEVENIKEEAGVKYIFEMWEKVEES
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaatcaaagaatttaccctcattgttgctgcgactaataagatgggagttggg
aaaggaggtggtcttccatggacgggattgagaaaggaaatggcctattttgcgagggtt
actaagagggctggtcctgggaaaacaaacgcagtagtaatgggacgcaaaacctgggaa
tcaatacctcctaaattccgtcctctcgcgaatagagcaaattacatgattagtcggaca
caaacttccaattctccggaagttgatctcggtcccgatgcacattcagcaacaagtttg
acggatgcactcgagaaattaggatcaagggcacaatcaaatacgaatcatgaggatgaa
aaagaaattgatagagttttcataattggtggaggacaaatatataaagcatcattggag
ttaaaggaggcaaagagaatattattaacaaggattttggaggattttgaatgtgatacg
tattttcctgttgagttgaaggaggatggaacagggaaggggtggagaaggacggataca
caagcacttcgagaatggactggggagggagaggaagttgagaatatcaaggaggaggct
ggtgtgaaatacatattcgagatgtgggaaaaggttgaggaatcataa

DBGET integrated database retrieval system