KEGG   Sclerotinia sclerotiorum: SS1G_09021Help
Entry
SS1G_09021        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SS1G_09021
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SS1G_09021
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SS1G_09021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 553 aa AA seqDB search
MHQTQRVAMVSDCRQAATNYWSDEELRDKVGQPFIVGFHGHVTNEDIKTLITVHRVGTII
LFQRNIADAAQLFQLAASLQEIAEDSGHAQSLFIATDQENGLVTRVNPPIATELPGSMAL
GAANDPSNAFSVAVCTAKILKAYGINMNYAPVADVNSEPKNFVIGVRSFSDDPGTVGRFV
SSQVEGLQQNGILSCVKHFPGHGDTAVDSHHGLPVITKSKEELEACELVPFWRAVKAGVD
AIMTAHISLPQLNSNSNVATNQLPASLSPDAIRILRQEMNYDGLIVSDCLEMDGVRATYG
TEKGAVMALKELTVSWCHTMKAQVGAIEAVIAAVKSGEISQEMIESSVNRVIRLKTKYLS
TNVSTADSNSNVQMLNEESSKVASEVYAKSTTVVRTEPGYLSIPRNSVKVLLLFASEAHL
GGGAVVSGEDRAARSLLLTYIETLKPYCESIIDIQFNEGYLLDPGHKDMIHFEEADMIIL
ATRNATFSPYQKAMGQFLGKCLISNKKFITIVTCDPYDFLEDRDFIKNYIAIDEPTVSAF
RAVVENQCIEALA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaaacacaaagagtggcgatggtatctgactgcaggcaagcagcaaccaattat
tggtctgatgaagaactgagggataaagttgggcagccttttattgttggattccatggc
catgttaccaacgaagatatcaagactctcatcacagttcacagagttggaaccatcata
ctttttcagagaaatatcgcagacgcagcccaacttttccaattagctgcttcattacaa
gaaattgcagaagattctggacatgctcagagtctcttcattgcaactgaccaagaaaat
ggacttgtgactcgtgtcaatccacctattgcaacagaacttcctggttcgatggctctg
ggagcggccaatgatccgtcaaatgctttcagtgttgctgtatgcacagccaaaatattg
aaagcatatggcatcaacatgaattatgccccagttgcagacgtaaactcagaaccaaag
aatttcgtcattggagtaagatcattttcagatgatccggggacagtgggaagatttgta
tcatctcaagtggaaggtttacagcaaaatggcatcctgtcctgcgtcaaacatttccct
ggccatggtgatacggccgttgactcccatcatggtcttccggttattactaaatccaaa
gaggaattagaagcctgtgagttggtaccattctggcgcgccgtgaaagctggtgttgat
gctattatgactgctcatatatctctacctcagttaaacagcaactctaacgtagctacc
aatcaattaccagctagcttgagccccgatgcaataagaatcttgcgccaggagatgaac
tatgacggtttgatagtaagtgattgtttagaaatggacggagttagagcgacttatggg
acagagaaaggagcagtcatggcattaaaggaactgactgtgtcatggtgtcacacaatg
aaagctcaagtcggtgccattgaagctgttattgctgcagtgaaatctggtgagatttct
caggagatgattgagtcttcagtaaaccgagttatacgactaaagactaaatatttatcc
acgaatgtttcaacggctgattctaactcaaatgttcaaatgcttaacgaagaatcgtca
aaagttgcatcggaagtttacgccaagagtacaactgttgtccgaactgagccgggatat
ctttcaatcccaagaaattccgttaaggttttattgttgttcgcatcagaggcacatcta
gggggtggtgctgttgtcagtggtgaggatagagcagcccgatccctactgctcacgtat
attgagactctaaagccttactgtgaatctatcattgacatacagttcaacgagggatat
ttattggatccaggtcacaaggacatgattcattttgaggaggctgatatgataattctt
gcgaccagaaatgcaaccttcagtccctatcaaaaggctatgggacaatttctaggcaag
tgtcttatttcgaacaagaagttcatcacaatcgtaacttgtgatccgtacgatttcctt
gaagatagggattttataaaaaattacatcgcaatagatgagcctactgtatcagctttt
agagcagtggtggagaatcaatgcatcgaggccttggcttag

DBGET integrated database retrieval system