KEGG   Sclerotinia sclerotiorum: SS1G_09434Help
Entry
SS1G_09434        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ssl  Sclerotinia sclerotiorum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1416 aa AA seqDB search
MTAVAVQHGAPRQQYNPHRSNASPNLISPSGQQPQPQSYPSATGSNSRELQNSTPGTLAT
MNSRHTVSNDPVQPVNGADAGYAYAQANPGRIHTATPNGSTPASTRPTTSAGATAESSQE
DSEPDRTRRRPAALLRRSKSDFGPTVEDTNVDMEDDIQDWGERHGFGTIYASEEYVSQLA
NNWYMYFTDKRHETTGNPKSLGYELQDWRMKDRLKTVSAALAICLNIGVEPPDQLKTTPG
AKLEAWQDPTHPPVQKALETIGKSLQAQYETLAIRTRYKQYLDPSVEETKKFCISLRRNA
KEERVLFHYNGHGVPKPTSSGEIWVFNKNYTQYIPVSLYDLQTWLQAPTFFVWDCSDSGN
ILSNFHRFVEKHEQEELENSKKDPNYIVTNYKPYIHLAACGVKENLPTNPLLPADVFTSC
LTTPIEMALWFFVLQNPLPSQITPERAKKLPGRLQERRTPLGELNWIFTAITDTIAWTTL
PRPLFRKFFRQDLMVAALFRNFLLSQRIMSAYGCHPQSYPELPDTHQHPLWESWDLAVEM
ALAQLPSLEKKEAGQLPDYEFQNSSFFTEQLTAFEVYLTQGAVTHKAPDQLPVVLQVLLS
QQHRVRALILLGRFLDMGPWAVNLALSIGIFPYVLKLLQSAAAELKPVMVFIWTRVLAVD
LTCQQDLLKDSGYNYFSSILRPNEGLPVVDSLEHKAMCAFILAMLCNGYKQGQNVCNQTD
IMTYCLTHLQNADNPLLRQWACLCISQLWNDLPEAKWRGIRENAPAKLSSLVRDVVCEVR
AAMLYAMTTFLGIPDLTDEVARNEESISWTVIEMANDGNAMVRKELLVYFSKLIHRYESK
FWVVAFEQLQEEREYRQHPPVDDGNDHKMGLHYASMENRNKDGTIKATAQGLSHNSIFAV
VWKHVLIMTIDPHPEVQRNATIIVDCVHTSLLQSPVGVAARSLFDDISRLSAKPKASKQH
VSEQRPSTPTRQDTLSSTSSSQQGLLKRTASYLFTLPFVGSTGEVTPPDSTGRSGLKSPG
LQRNSLPMRSRLPPDFNTPPEQNDIASTPGTYHVANEPTSGGFQPRKLSDPISIPLESTF
LEWSIEYFREPQMKQNEAEEPGSTDYNERLWRRSRNEAILRETQPQKEIAGNGKWTHATG
FFNNSSQPTKMTLHQFEDHLAVSDDRDTICVWDWKKQDRLSRFSNGNPEGSRISDLQFIN
EDDQAFLLTGSSDGVIRIYRNYDSDKKIEVASAWRALTHLVPSNVNSGMVFDWQQVTGKL
LVAGDVKVIRVWAAAAELCIVDINARSGSCVTSLTSDQMTGNVFVAGFGDGAIRVFDARN
KPQEAMVKKWKDESDRVWIKNVHMQRGGQRELLSASRNGKVKLWDIRMDKPLRVIQATKE
TLRTASTHEHLPVFAVRRLDRLSHCLAYWELWLNMN
NT seq 4251 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagttgcagttcaacatggagctccccgccaacagtacaatccacaccgatca
aatgcctctccgaatttaatttcaccctctggtcaacaacctcagcctcaaagttatccc
tccgccacggggtcgaattcaagagaactgcaaaactccactccgggcacattagcgacg
atgaattcgaggcatactgtgagcaatgatccagtccagcctgtcaacggcgcagatgcg
ggatatgcatatgcgcaggcaaatccaggtcgcattcataccgcaacgccgaatggatca
acaccagcaagcacgcggccgactacttcggctggagctacggccgaatcatcacaagaa
gactctgagccagatagaacacggcgcagaccggccgcattacttcggagatcaaaaagt
gattttggcccgacggtggaagatacaaatgtagatatggaagatgatatacaagattgg
ggggaaagacatggatttggaactatttatgcatccgaagagtatgtttcgcaactagca
aataactggtacatgtactttacggataaacgacacgaaacgacgggcaaccctaagtca
ttgggatatgaacttcaggattggcggatgaaggatcgtctaaagacagtttctgcagcg
ttagcaatatgcctaaacattggagtcgaaccacccgatcaattaaagactacacccggt
gcaaaattggaggcttggcaggatcccacacatcctcctgtacaaaaagctttggaaacg
attggaaaatctctacaagcccaatacgagacattggccattcgaacgagatacaagcag
tatttagacccatcggtagaggagacgaagaagttctgcatatcactccgccgaaatgcc
aaagaggagcgcgttctcttccactacaatggccatggagttccaaaaccgacctcatct
ggcgaaatttgggtattcaacaaaaactacactcagtacattcctgtctcgttgtatgat
ttacaaacttggttgcaagcacctacattcttcgtttgggactgttcggattcaggtaac
atactaagtaacttccatcgatttgttgagaagcacgagcaggaagagcttgagaattcg
aagaaagacccaaactatatagttacgaactataaaccttacatccacctggcagcatgt
ggcgtaaaggaaaatctacccacaaatcccctgcttcctgctgatgtgtttacatcatgt
ctcactacacctatcgaaatggcattatggtttttcgttcttcagaatccacttccatct
cagatcacaccagagcgggccaaaaagcttcctggtaggctacaagagagacgaactcct
ttaggagagttgaactggatatttacagcaatcacagatacaatagcttggactactctt
cctaggcctttgttcagaaagttcttcagacaagatttaatggttgcagctttattcaga
aactttctgttgtcacagaggattatgtcggcctatggatgccacccacaatcgtatcca
gagcttccggacactcatcaacatcctctttgggaaagttgggatttggcagtggaaatg
gctttagcacaattaccatcgctagagaagaaggaggcagggcaacttccggactatgaa
tttcagaattccagtttcttcacagaacagcttacggcatttgaggtttacctgacccaa
ggcgctgtaacccacaaagctcccgatcagcttccagtggttcttcaggtacttcttagc
cagcaacatcgagtacgagccttgatactattaggaaggtttctcgacatgggtccctgg
gcagtaaatctcgctttgagcataggcatcttcccgtatgttttgaagttgctgcaatcg
gcggcagcagagttgaagcctgtaatggtgttcatctggactcgtgttctggctgttgac
ctcacatgtcaacaagatctattgaaagatagtggctacaactacttttcgagtatactg
agaccaaatgaagggcttccagtggtagatagccttgagcataaagctatgtgtgccttc
atccttgccatgctttgcaatggatacaagcaagggcaaaatgtctgcaatcaaacagac
atcatgacttactgtttaacacatttgcagaatgcagataatccacttttgcgtcagtgg
gcgtgcctatgcatcagtcaactctggaatgatcttccagaagcaaaatggcgaggcatc
agagagaatgcgcccgcgaagttgtctagtctggttcgtgatgtggtttgcgaagtgaga
gccgccatgttatatgccatgacaactttcttgggaatccctgatctgacagacgaagtt
gcccggaacgaggagtcaatatcctggactgttatcgaaatggcaaatgatgggaatgcc
atggtccgcaaagaacttctagtctatttctccaagcttatacatcgatatgagagcaag
ttttgggttgttgcattcgagcaattgcaagaagaacgagagtaccgacaacaccccccc
gtcgacgatgggaatgatcataaaatgggactccattatgcgagtatggaaaacagaaat
aaggacggtaccatcaaggccacagctcagggcttatcacacaattctatctttgccgtg
gtttggaaacatgttctgatcatgacaatcgatccccatcctgaagtccagcgcaatgca
accatcatcgtggactgtgttcatacatcgctccttcaatcacctgttggagttgcagca
cgcagtctgtttgacgatataagtcgactttcagcgaaaccaaaggcttcaaaacaacac
gtctccgagcagagaccaagcacaccaacgaggcaagataccttatcgagtacaagttct
agccagcaaggtttactcaaaagaacggctagttacctgtttactttaccgtttgtaggt
tccactggtgaagtcacgcccccggactcaactggaagatcagggttgaagtcaccaggc
cttcagcggaattctctgccgatgcgatcacgtctcccaccagatttcaacaccccaccg
gaacagaacgacatcgcatcgaccccaggcacatatcatgtagcgaatgagccaacctcg
ggtggatttcaacctcgaaagctgtcggatccgatttccatacccttggaaagcactttc
ttagaatggtcgattgaatatttccgcgagccccaaatgaaacaaaatgaggctgaagag
cccggtagtactgattataacgaacgactttggcgtagatcaaggaatgaagcaatcttg
cgagaaactcaacctcagaaagaaatcgctggtaatggtaaatggacacacgctaccgga
ttctttaacaactccagtcagccaacaaaaatgactctccatcaatttgaagatcatctt
gctgtgtctgatgatcgtgatacaatttgtgtttgggactggaagaaacaagaccgcttg
agtcgattctcgaatgggaatccggagggctcaagaattagcgatctccagtttatcaat
gaagacgatcaggcgtttttgttgacagggtcctcagatggtgtgattcgtatatatagg
aattatgactctgacaaaaagattgaggttgcttcggcttggagagctctgactcatctt
gtcccaagtaacgttaattctggaatggtatttgactggcaacaagtgacgggcaagcta
ttagtggccggtgatgtcaaggtgattagggtatgggctgcggcagcggagctttgcatt
gtggatattaacgcgcgatctggttcttgtgttacttcattaacttcggatcagatgaca
ggaaatgttttcgtggccggttttggtgatggagctattcgagtattcgacgctcgaaac
aagccacaagaagctatggtaaagaaatggaaggacgaatctgacagggtatggatcaag
aatgtacacatgcaacgaggtgggcaaagagagcttctctccgctagccgtaatggcaaa
gttaaactttgggacattcgaatggataaaccactacgagtaatccaagctacaaaggaa
accttacgtactgcaagcactcatgagcatcttccggtattcgctgtaaggcgtcttgat
cgattatcacattgtttggcgtactgggagttgtggctaaacatgaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system