KEGG   Sclerotinia sclerotiorum: SS1G_09610Help
Entry
SS1G_09610        CDS       T01071                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SS1G_09610
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SS1G_09610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MVQFSNQDGNKEEAEKETREFNGGNSKRKSESNWEGGEMTKKKKRKSKANGHHGHRRHSV
STKPARDPRDEAADTPEETPVEVSRSPSPVIDFDGLSRPSKGARERLDESPEQAAVRMSK
LTGAVRTILECIGEDPDREGLLATPERYAKAMLYLTKGYQENVRDIVNDAIFHEDHNELV
IVKDIEVFSMCEHHMVPFTGKMHIGYIPDRNVIGISKLPRIADMFSRRLQIQERLTKDVA
HAVMEILKPQGVAVVMESSHLCMVMRGVEKTSATTITSCVLGCIEKREKTRNEFFSLVGL
NRR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattctccaaccaagatggaaacaaggaggaagcggagaaggaaaccagggaa
ttcaatggaggaaattccaagcgcaaatctgaaagtaattgggaaggcggagaaatgact
aagaagaagaagaggaagtcaaaggcgaatggtcatcatggacatcgaagacatagtgtc
agcaccaaaccagccagagatccaagagatgaggcggcagacactccggaagagactcct
gttgaggtttcgagaagtcccagtccagtcattgattttgatggtttgagtcggcctagc
aaaggcgcgcgagaacgtcttgacgaatctccagaacaagcagctgtccgcatgtcaaaa
ttgacaggcgcagttcgcacaatcctcgaatgcataggtgaagatccggatcgagaaggt
ctcttagccacccccgagcgatacgcaaaagcaatgctatacctcacgaagggatatcag
gaaaatgtcagggacattgtcaatgatgcaattttccatgaggaccacaatgaattagta
attgtcaaagatatcgaggtcttcagtatgtgcgagcatcatatggttccattcactgga
aagatgcacattggctatattccagatcgaaatgtcatcggtatttcaaagttaccacga
attgcagacatgttttcacgaaggctacaaattcaagagaggctcaccaaagatgtcgca
catgccgttatggaaattctcaaaccacagggcgtggcagttgtcatggaatcgagccat
ttatgcatggtcatgcgtggggttgagaaaacaagtgctacgacgattacgagctgtgtt
cttggttgcatagaaaaaagagagaagactagaaatgagtttttcagcttggtgggcttg
aatagaagatag

DBGET integrated database retrieval system