KEGG   Sclerotinia sclerotiorum: SS1G_09629Help
Entry
SS1G_09629        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SS1G_09629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MADVNADWSADSNEAIYISLVSPSTGGTTSLHTFTPKFTYPIFGDEESIFGYQGLRINLK
YNACDMRPGLQITYNKKFKAVGDIEPTDLKATLEPFLPKTAFEKSSVFDSNISAVPADWH
PPGELFRAIEVGGETFEIWKGILSDPVIQQTIRRIQILVPLFIEGGTLLDLDESEDDLER
WTVFFLYHKKPSPASFFGKSSSYVFMGFSTVYRYYMYTPTTPPQTPNGDKIAPEFTLPVN
GVSFNTLPCRSRISQFMILPPFQSGGKGSLFYNAIFDYLSDDPHTREITVEDPNEAFDDL
RDINDLARLRKDERFLKLKLDSTLKINRKGPAPTKLFDTKAYEDLRTQMKIAPRQFARVH
EMYLLSIIPQSVKAAPLHDTEETSKKSLPPPRKEDEHIYHLWQLLVKQRLYRHNKEALAQ
LDRGERIDKLNETLMGVEADYGRLIEAVNERSEKEKPTAAGKGKEKSTANENGKRAVGGE
DEDDEEEDENDVPLAKRLKFAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgttaatgccgattggtccgctgattccaatgaagctatctatatctcactg
gtctctccaagcacaggaggcacaacctcacttcacaccttcaccccgaagttcacatat
cccatattcggagatgaggagtcgatatttggataccagggcttgaggatcaacttaaaa
tacaatgcctgtgacatgcgacccggcctacaaattacttacaacaaaaagttcaaggca
gtgggtgatatagaaccaacggatttgaaggcgacgctggaaccattcttaccaaagact
gcttttgaaaagtcaagtgttttcgattcaaatatctcggctgtcccagcagattggcat
ccaccgggagaactctttcgcgcaatcgaggtcggtggagagacatttgaaatatggaaa
ggtatcctctctgatccagtcattcaacaaaccatcaggcgcattcaaatattagttcct
ttgtttattgaaggagggacgttacttgatctcgatgaatcagaggatgatcttgagcga
tggactgtgtttttcttataccacaagaagccatccccagcctcatttttcgggaaatct
tcatcatacgtcttcatgggcttttctaccgtctatcgctattacatgtatacacctacg
actccgccacaaactcccaatggtgacaagatagctccggaatttacgcttcccgtcaat
ggagtctcgttcaatactcttccatgtcggtcaagaatatctcaattcatgattcttcca
ccctttcaaagcggggggaagggatcactgttttataatgcaatatttgattatttgtct
gatgatccacatacaagagagatcacagtagaggacccgaatgaagcattcgacgattta
agagatattaacgacctagctcgtctacgcaaagacgaaagatttctcaagttgaagctc
gattcaacgttgaaaatcaaccgtaaagggccagctcccacgaaactttttgacactaaa
gcatacgaagatctccgaactcaaatgaaaatcgcccctaggcaatttgcccgcgtgcat
gaaatgtaccttctgtccataattccacagtcagtcaaagcagcccctctccacgacaca
gaagaaacatccaaaaaatctttaccgccccccagaaaagaagatgaacatatatatcat
ctctggcaactcctcgttaaacaacgtttatatcgccataataaagaggccttggcacaa
ttagaccgcggagagagaatcgataaattgaacgagactttgatgggtgtagaagctgat
tatggaagattaattgaggcggtcaatgagaggagtgaaaaggagaaaccgactgctgcg
gggaagggaaaggaaaagagcacggctaatgagaatgggaagagggctgttggtggggag
gatgaggatgatgaagaagaagacgagaacgacgtaccattggctaagaggttgaagttt
gcttcctaa

DBGET integrated database retrieval system