KEGG   Sclerotinia sclerotiorum: SS1G_09697Help
Entry
SS1G_09697        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SS1G_09697
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SS1G_09697
   04113 Meiosis - yeast
    SS1G_09697
Protein phosphatases and associated proteins [BR:ssl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SS1G_09697
Ubiquitin system [BR:ssl04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SS1G_09697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 836 aa AA seqDB search
MPPSRKETINPCITTQLCQLIYYHLDNNLLNNALFFAERLHAYTPKGPESSYLLSLCHLR
LGDYASAFEVVKSPGNKMGNLGCAYIYAQACLALGKLKEGIVALEKNRGCWGAQNSFGKH
SEYSRHPYPDASAVCCLLGKLYRAFDDKKQSISYFEDALKLNPFMWDAFTNLCDMGTSVR
ASSTFRMSVEMEAILKTNSQEREAPMEPMFVEEPKLIRPSARTYQSEPVDPFNNNSTSRS
FAGGLFGSLTTSASSKLAESNPSLTNLPATGNGSISSDTMETPTGPSVPPDYSIVPSRKE
PGVISAFPINMEPPQAPARRNRTLQGLGMDFSMDVPKMGRSMTSKRLQKAAAEISEDSSA
GHNSRHNSVTAPGGERKRTISGQVVPRQPSEDPGAPQRRSVRLINQFRPTSNKPSSNLAT
VGPAPGRELKKARPPISKIMRPVGASTAGRQVSGNRKPVEESMELDQREGEIRSRAPVST
KSSGARSSESDSGTREEAIRWLLDLFKKFGTGYYLLARFQSRQALEAFSTLSTQQQDTPW
VLSQMGRANYEQASYAEAEFLYRRIRQIAPTRFQDMEIYSTVLWHLKKETDLAFLAHELV
DSSWQSPEAWCALGNSWSLMRDHEQALRCFKRATQLNPKFAYAFTLQGHEHVMNEEYDKA
LTSYRHAMAVDRRHYNAYYGVGKVYEKMGNYDKAFIHFEAASKINPTNAVLLGLMGSVVD
KKGNKALALAYFKKAIELDPKSALTRFKKARCLMTMGNMEDALEELKILKDLAPDEAMVH
FLLGRLYKSIKQKGASVRHFTIALNLDPKASQQIKEAIESLEQGDDDEDDETSMMG
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgcctccctcaaggaaggaaacaatcaatccttgtatcacgacccaactgtgtcaactc
atttactatcaccttgacaataacctgctcaataatgccctgttcttcgcagagcggctg
catgcttatacccccaaaggccccgaatcctcctacctcctgtcattatgccatttacga
cttggcgattatgcttccgccttcgaggtggtaaagagcccagggaataagatgggaaat
cttggatgtgcatacatctatgcacaagcatgccttgcactgggaaaattgaaagaaggg
atcgtggcgttggaaaagaatagaggctgctggggggcacaaaactcatttggcaaacat
tcagaatactcgcgacatccatatcctgacgcatctgcagtctgttgtctactggggaag
ctatatcgcgcttttgatgacaaaaaacagtcgattagctatttcgaagatgcgctgaaa
ttgaatccattcatgtgggatgcttttactaatctttgcgatatgggcactagcgttaga
gcttcgagtacttttaggatgagtgtagagatggaggcaatactgaaaacgaattcacaa
gaaagagaggcgccaatggaacccatgttcgtggaggaacccaaactgatccgtcccagc
gcgcgaacttaccagagtgaacccgtggatcctttcaataataattccacgtctcgatca
ttcgccggtggcctttttggatcacttactacctctgcatcctcgaagctcgctgagagc
aatcccagtcttacaaatcttcccgcgactggaaatggcagcatcagctctgatacaatg
gaaacaccgactggtcctagtgtccctcccgattattctattgtgcccagtcgaaaagaa
cctggtgtgatatcagcttttcctattaacatggaacctccacaagccccagctcgcagg
aaccgaaccctacaggggctcggtatggactttagcatggacgttccgaagatgggtcga
tccatgacatcgaaacgacttcaaaaggcggcagctgaaatttcagaggacagtagcgca
ggacacaattctcgccacaactctgttacggcaccgggtggagaaaggaagcgaaccata
tcgggacaggtagtacctcgacagccctcagaagaccctggagcacctcagagaaggagt
gtcagattgatcaaccagttccgccccacaagcaacaaaccttccagtaaccttgcgact
gtggggccagcgcccgggcgagaattaaagaaggctcgacctccgatatcaaaaatcatg
cgaccggttggagcatcgaccgccggcagacaggtcagcggtaatcgaaaaccagtggaa
gaatccatggaattagaccaacgggaaggagagataagatcccgagcgccggtatctaca
aaatcttctggtgctaggtcatccgaatcagactctggaactcgggaggaggctataaga
tggctcctcgacttgtttaagaagttcggcactggctattatttacttgccaggtttcag
tctcgtcaagctttggaagcgttctctacattatctactcagcagcaagacacgccttgg
gtattgtcacagatggggcgtgctaattacgaacaagcatcatatgctgaagcagaattc
ttatacaggcggattcgacaaatagcaccaacacgcttccaggatatggaaatatattct
accgttctttggcatttgaaaaaagagactgatctagcctttcttgcgcatgagttggtc
gattcttcgtggcaatcaccagaggcttggtgtgcgctgggaaattcctggtcacttatg
cgagatcatgagcaagctttacgttgtttcaagcgggctacccaacttaatcctaagttt
gcttatgcgtttactcttcagggtcatgagcatgttatgaatgaagaatatgacaaggca
cttacttcatacagacatgcaatggctgttgataggagacactataacgcctactatggt
gttggtaaagtatatgagaagatgggtaattacgataaagctttcatacacttcgaagcc
gcttccaaaatcaacccaacgaatgccgtgctattgggtcttatgggaagtgttgttgat
aagaaggggaacaaggcactggcactagcatacttcaaaaaggcgattgagttggatcct
aaatcggccttgacccgtttcaagaaagctcgatgcttaatgacaatggggaacatggaa
gatgctttggaggaattaaagatcctgaaagatttggctcctgatgaggcgatggttcat
ttcttactgggtagactgtataagagtatcaaacagaagggtgcttcagttcgacatttt
accatcgctctaaacctagaccctaaggccagtcaacaaataaaagaagccatcgaaagt
ttagagcaaggggacgacgatgaagatgatgaaaccagcatgatggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system