KEGG   Sclerotinia sclerotiorum: SS1G_09867Help
Entry
SS1G_09867        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SS1G_09867
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     SS1G_09867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 509 aa AA seqDB search
MATSPTPSSSIPPSGQSAASGSAGHSDIENTLFVSKDVSLTLTPESLVIKGAGPRRSVTL
DASTSSEPVGSSNSRAIPLHHILWAELIEKELIINYAKELSKTILQPAILKYVIEEERDR
VEAWISSLKDRAYGQSQQQKRAKVLINPKSGKGQSEKIYAKDVSPILEAAHLIIDVTVTK
ATKEAIDIVEKLDIEAYDVIICCSGDGLPFEVFNGLGKRKDAKRALSKMAIAHIPCGSGN
GLHCSLHGNIRSASIAALSIVKGIRTPLDLISVTQGEERHLSFLSQALGIVAEFDLGTEH
LRWMGGTRFIYGFVLKSLQKKIYPCDIAVKVVTDDKEEIKRRYHEAMQLGGTPEEVLRGN
DSLEGGLPELKYGTSTDPLPQDWKVEQHDNMGSFYCGNMSWMGADVDYFPAALPSDGCMD
MVTIDYSNLSRLQALQLFPAVESGKFFGLPYVNYRKVEAYRITPKNQPNGYISIDGERVP
FAPFQAEVHRGLGTVLSVSGYKYETPGPK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatctcctacgccctctagctcaattcccccatcaggtcaaagtgctgcaagt
ggtagcgctggacattccgacattgagaatacactttttgtcagtaaagatgtatcatta
accttaactcctgagtccttagttatcaaaggagcaggtccccgtcgttctgtgacacta
gatgcatccacctcttcggagcccgtgggctcttcaaattcacgtgcaatacctttacat
cacattctttgggcagaattgattgagaaagaactcatcataaattacgcaaaggagctt
tcgaagactattcttcaaccagcaatactaaagtatgttattgaagaagaacgagatcga
gtagaagcatggatttctagccttaaagatcgagcatatggtcaatcccaacaacagaaa
cgagctaaagtattaattaatccaaagagtggaaaagggcaatcggagaagatctatgca
aaagatgtttccccaattctcgaagctgcccatctgataattgatgtgacagtaaccaaa
gccacaaaggaagccattgatatcgtggaaaaacttgatattgaagcttacgatgtgata
atttgttgttctggagatggtcttccatttgaggttttcaatggtcttggaaaacgtaaa
gatgcgaagcgagctctctcgaaaatggcgattgcgcatattccttgtgggtccggaaat
gggttacattgcagtcttcatggtaatattagatctgccagtattgcagctctttctata
gtcaaaggtattcgtacgccattagatttaatctcagtcacgcagggtgaagaaagacat
ttatcattcctctcccaagcccttggtatcgtggctgaatttgatctgggaacagagcat
ttgcgatggatgggaggaacaagatttatctatggttttgttttgaaatctcttcaaaag
aaaatttacccttgtgatattgctgtcaaggtggttacagatgataaagaagaaatcaaa
cgacgttatcatgaagctatgcagcttggtggtacaccagaagaagtcttacgaggaaat
gattcattagagggtggcttaccggaattgaagtatggaacttcaaccgatccattacct
caagattggaaagtcgaacaacatgataacatgggaagtttttattgtggtaatatgtct
tggatgggcgcagatgtggattattttccagctgcacttccaagtgatggttgtatggat
atggtcaccatcgattattctaatctcagtcgactccaagcattacaactttttcccgct
gtcgaaagtggtaaattttttggccttccatatgtcaactaccgaaaagtcgaagcatat
cgcatcactccaaagaatcaacccaatggttatatatccattgacggagagcgagtacca
tttgcaccattccaagctgaagtgcatcgtggtttgggcacggtactatcagtatcaggt
tataaatatgagactccaggtcctaagtaa

DBGET integrated database retrieval system