KEGG   Sclerotinia sclerotiorum: SS1G_10038Help
Entry
SS1G_10038        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssl00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ssl00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ssl00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ssl00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 579 aa AA seqDB search
MLSSTFLISALVSSALAIWPQPVSYTNGTGVLWLDRNVKVTYDGGLSTGYSVDGAGNVTN
SKTIVSSAVTRAMTKIFYQGLTPWKFYARNTLSQVEPSATSNKTYITELYIAQTGHDNSS
TFKPTDGQVDESYNLTITTDGKATISAPSSIGILHALTTFTQLFYTHSVAKAGVYTKLAP
VTIYDAPKFAHRGMNMDISRNWYPVEDIKRTMLALHYSKCNVIHLHITDAQSWPLDIPAL
PELSKLGAYQTGLSYTPQDLKEIQEYGTNLGLEVILEIDMPGHTSSIGFSHPELLAAFNA
EPWDTYCAEPPCGSLRLNDSAVPAFLETLLNDLLPRVSPYSSYFHTGGDEVNVNTYLLDP
TVQSNDTEVLRPLIQAFVDRNHQQVRAAGLTPMVWEEMLTTWNLTLGPDVLIQSWLSDAS
VAQIVGAGHKAIAGNYNFWYLDCGKGQWLNFQPGASSQAYYPYLDYCSPTKNWRLVYSYD
PLAGVPENSTHLVVGGEFHIWSEQTDAINIDDMVWPRGAAAAEVLWSGAKDPVTGQNRSQ
IDAGSRLPEFNEHLRTMGIRSGPVQMIFCTQSDSTECSL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttcgacatttctaatatctgctttggtttcctctgccctggctatttggcct
caacccgtctcgtacacgaatggtactggtgttttgtggttggatcggaatgttaaggtt
acatatgatggcggcctttctacaggatattctgttgatggggctgggaatgttacaaat
agcaaaactattgtttccagtgctgtaactcgtgccatgaccaagatcttctaccagggt
ttgacaccatggaaattctatgcacgaaataccttgtcccaagttgagccctcggccact
tcaaacaagacctacattaccgaactctacatcgcccagaccggacacgataattcctcc
acctttaaacctacggatggccaagtagacgaatcttataacctcaccatcactactgac
ggaaaggccaccatcagcgccccctcgtctatcggcatacttcatgcactgacaacgttc
acacaacttttctacacacattccgttgctaaggccggcgtctacacgaaactagctcct
gtgacaatttatgatgcaccaaagtttgcccatcgtgggatgaacatggatatatctaga
aattggtatcccgtggaagatatcaagagaacgatgttggccttgcattacagcaaatgc
aatgttattcatcttcacatcactgatgctcagtcatggcctttggatattccagcactt
cctgagttgtccaagttgggtgcttaccaaaccggattgtcatataccccccaagactta
aaggagatccaagaatatggaactaatcttggcctcgaggtcattttagaaattgacatg
cctggtcatacaagctcaattggattttctcatcctgagctcttggccgctttcaacgcc
gaaccctgggatacctactgtgctgaacctccttgtggatcgttgagacttaatgactcc
gccgtaccagcattcctggagacactgttaaatgatcttcttcctcgagtctccccatat
tcatcgtacttccacactggtggagacgaagtcaatgttaatacttatttgctggatcct
acggttcagtcaaatgatacagaggttcttcgaccattaatccaggcattcgtggacaga
aaccaccaacaagtcagagctgctggacttacaccaatggtttgggaagaaatgctcaca
acatggaacctcaccttgggaccagatgttctcattcaatcatggctcagtgatgcctca
gtcgctcagatcgtcggtgctggacataaagctattgctggcaactataacttttggtat
ctcgattgcggcaaaggacaatggctcaacttccaaccaggagcatcctcccaagcttac
tacccctacctcgattactgttctcctaccaagaattggcgtctagtctactcttatgat
cctctcgccggagtcccggaaaactcaactcacttggttgttggcggagaattccacatc
tggtccgagcaaaccgacgccatcaacattgacgatatggtatggccacgaggagctgcg
gccgcggaagtcttgtggtcaggagccaaggatccagtaactggacagaatagaagtcaa
atcgacgcaggcagtagattgccagaattcaatgagcacttgagaaccatgggaatccga
tcgggacctgtacaaatgattttctgcacgcaatcggactcaaccgagtgttcattgtaa

DBGET integrated database retrieval system